SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012094 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012094
Domain Number 1 Region: 26-83,115-175
Classification Level Classification E-value
Superfamily POZ domain 8.63e-28
Family BTB/POZ domain 0.001
Further Details:      
 
Domain Number 2 Region: 372-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000888
Family Classic zinc finger, C2H2 0.00082
Further Details:      
 
Domain Number 3 Region: 429-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000126
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 4 Region: 564-595
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000283
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000012094
Domain Number - Region: 309-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00158
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012094   Gene: ENSMODG00000009674   Transcript: ENSMODT00000012318
Sequence length 597
Comment pep:known_by_projection chromosome:BROADO5:3:512628373:512692214:-1 gene:ENSMODG00000009674 transcript:ENSMODT00000012318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRGAARPAGCAVAGRGWRAPGPSSGCYTYQVSRHSTEMLHNLNQQRKNGGRFCDVLLRV
GDESFPAHRAVLAACSEYFESVFSAQLAEGGPGGPDAGGPQDVTGAAGGPGPAGAGPSRE
LEMHTISSKVFGDILDFAYTSRIVVRLESFPELMTAAKFLLMRSVIEICQEVIKQSNVQI
LVPPARADIMLFRPPGATDLGFPLDMTNGAGLGPNGNGIAGSMQPEDEAARAAGAAIAGQ
ASLPVLPGVDRLPMVAGPLSPQLLTSPFQNVGSSAPPLTGKRGRGRPRKANLLDSMMFGS
PGGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDIPPQRVGENGLPIPEDP
DGPRKRSRTRKQVACEICGKIFRDVYHLNRHKLSHSGEKPYSCPVCGLRFKRKDRMSYHV
RSHDGSVGKPYICQSCGKGFSRSPFLWGDEMGTHPDSLCHPQTCNASFATRDRLRSHLAC
HEDKVPCQVCGKYLRAAYMADHLKKHSEGPSNFCSICNREGQKCSHQDPIESSDSYGDLS
DASDLKTPEKQSANGSFSCDMAVPKNKMEPDGEKKYPCPECGSFFRSKSYLNKHIQK
Download sequence
Identical sequences F6SH52
ENSMODP00000012094 ENSMODP00000012094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]