SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012192 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012192
Domain Number 1 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.38e-24
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.71e-23
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 121-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.56e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 236-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.57e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 177-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.39e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 1-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.55e-22
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 7 Region: 439-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.45e-20
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 8 Region: 478-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.31e-17
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 9 Region: 337-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000125
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012192   Gene: ENSMODG00000009755   Transcript: ENSMODT00000012417
Sequence length 526
Comment pep:novel chromosome:BROADO5:1:746859047:746864562:-1 gene:ENSMODG00000009755 transcript:ENSMODT00000012417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLVTFRDVAVDFTREEWRLLSPRQKELYKEVMLENAGNLLSLGLPVPREDVISYFEQKDV
PWMLEQKALRSFCPGHSGEETRKPRSMRDAGPREFTLRENGAKQPRLHRRENAASNLYEK
TFPRSSGFARRQRIHTGEKLYACSQCGKTFRWSSSLAQHQRIHTGEKPHECEQCGKAYTQ
KASLVLHQKRHTGEKPHECEQCGKAFSKSSSLAFHEKVHKGEKPYECGQCGKILKCSFSL
VVHQRIHTGEKPYQCGQCGKSFRQFYKFAEHQGIHTGEKPYECPQCGKTFRRSNNLVKHQ
RIHTGEKPYKCRHCGKTFSQGSQLVFHERTHTGEKRYECDECGKAFTWNSSLALHQKIHR
GERPYECTECGKTFRVRAILNLHRRIHTGENLYECSQCGKAFTQKSNLTQHVRTHSGEKP
FECGQCAKAFKYKKSLDLHKCRFVVHRRIHTGERPYACSQCGKTYTQRGHLTVHQRIHTG
EKRYACQQCGKAYTQGSHLTVHLRVHSAEKPYECGQCGKAFRRKQG
Download sequence
Identical sequences F6WT62
ENSMODP00000012192 ENSMODP00000012192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]