SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012374 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012374
Domain Number 1 Region: 175-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000114
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 2 Region: 137-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000184
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 3 Region: 950-1001
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000461
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 4 Region: 654-706
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000113
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 801-849
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000141
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 6 Region: 302-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000452
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 7 Region: 713-761
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000943
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 8 Region: 496-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000136
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number 9 Region: 1213-1267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000152
Family Classic zinc finger, C2H2 0.064
Further Details:      
 
Domain Number 10 Region: 1275-1326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000286
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000012374
Domain Number - Region: 742-795
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000735
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number - Region: 902-959
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00126
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number - Region: 1145-1179
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00517
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number - Region: 425-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0411
Family Classic zinc finger, C2H2 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012374   Gene: ENSMODG00000021509   Transcript: ENSMODT00000012599
Sequence length 1331
Comment pep:known_by_projection chromosome:BROADO5:3:258760176:259107886:1 gene:ENSMODG00000021509 transcript:ENSMODT00000012599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRKQAKPRSLKVEENEAEDHQEGVGQTATQSDPNCKLEDKTEDGDALDCKKRPEDGEE
LEEEAVHSCDSCLQVFESLSDITEHKINQCQLTDGVDVEDDPTCSWPASSPSSKDQTSPS
HGEGCDFGEEEGGPGLPYPCQFCDKSFSRLSYLKHHEQSHSDKLPFKCTYCSRLFKHKRS
RDRHIKLHTGDKKYHCSECDAAFSRSDHLKIHLKTHTSNKPYKCAICRRGFLSSSSLHGH
MQVHERNKDGSQPGSRMEDWKMKDTQKCSQCEEGFDFPEDLQKHIAECHPECSPNEDRAA
LQCVYCHELFVEETSLLNHMEQVHGGEKKNSCSICSESFHTVEELYSHMDSHQQPESCNH
SNSPSLVTVGYTSVSSTTPDSNLSVDSSTMVEAAPPLPKSRGRKRAAQQASDITGPSSKQ
AKVTYSCIYCNKQLFSSLAVLQIHLKTMHLDKPEQAHICQYCLEVLPSLYNLNEHLKQVH
EAQDPALIVSAMPAMVYQCNFCSEVFNDLNTLQEHIRCSHGFANPAAKDSNAFFCPHCYM
GFLTDSSLEEHIRQVHCDLSSSRFGSPVLGTPKDPVVEVYSCSYCTNSPIFNSVLKLNKH
IKENHKNIPLALNYIHNGKKSRALSPLSPVTIEQTSLKMMQAVGGAPQRPTGEYICNQCG
AKYTSLDSFQTHLKTHLDTVLPKLTCPQCNKEFPNQESLLKHVTIHFMITSTYYICESCD
KQFTSVDDLQKHLLDMHTFVFFRCTLCQEVFDSKVSIQLHLAVKHSNEKKVYRCTSCNWD
FRNETDLQLHVKHNHLENQGKVHKCIFCGESFGTEVELQCHITTHSKKYNCKFCSKAFHA
IILLEKHLREKHCVFETKTPNCGTNGASEQVQKEEVELQTLLTNSQESHNSHDGSEEDVD
ASEPMYGCDICGAAYTMETLLQNHQLRDHNIRPGESAIVKKKAELIKGNYKCNVCSRTFF
SENGLREHMQTHLGPVKHYMCPICGERFPSLLTLTEHKVTHSKSLDTGNCRICKMPLQSE
EEFLEHCQMHPDLRNSLTGFRCVVCMQTVTSTLELKIHGTFHMQKTGNGSAVQTTGRAQH
LQKLYKCASCLKEFRSKQDLVKLDINGLPYGLCAGCVNLSKSGSPNISIPSSSSRPGLGQ
NENLASMESKVKAGGLKTRCSSCNVKFESESELQNHIQSIHRELVPDSNSTQLKTPQVSP
MPRISPSQSDEKKTYQCIKCQMVFYNEWDIQVHVANHMIDEGLNHECKLCNQTFDSPAKL
QCHLIEHSFEGMGGTFKCPVCFTVFVQANKLQQHIFSAHGQEDKIYDCTQCPQKFFFQTE
LQNHTMTQHSS
Download sequence
Identical sequences F6VD07
XP_016287136.1.35504 ENSMODP00000012374 ENSMODP00000012374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]