SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012384 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012384
Domain Number 1 Region: 97-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.62e-16
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 1541-1590
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.6e-16
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 1230-1277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000042
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 4 Region: 672-721
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000293
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 5 Region: 756-810
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000508
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 6 Region: 644-679
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000239
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 7 Region: 1430-1460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000467
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 8 Region: 206-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000436
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 9 Region: 58-104
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000474
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000012384
Domain Number - Region: 315-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000411
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012384   Gene: ENSMODG00000009892   Transcript: ENSMODT00000012609
Sequence length 1736
Comment pep:known_by_projection chromosome:BROADO5:3:337336871:337413644:-1 gene:ENSMODG00000009892 transcript:ENSMODT00000012609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSKSPTSLEGSDLSSINTMMSAVMSVGKIAENGGNTQAIKSPTKSSGPNRIGRRNQETK
EEKSSYTCPLCEKICTTQHQLTMHIRQHNTDTGGTDHSCSICGKSLSSASSLDRHMLVHS
GERPYKCSVCGQSFTTNGNMHRHMKIHEKDPNTTTSTTPPSPLKRRRMTSKRKLSHEAES
EKEELTPAKKMIEDPQSGDTEKKTDEVFHCPVCYKEFVCKYGLETHMETHPDNPLRCDIC
CISFRTHRGLLRHNAVIHKQFPRDPTGKPFIQNNPSIPAGFHDLGFTDFSCRKFPRISQV
WCETNLRRCISEFHRFICETCNKAFPMLSALKLHTQTHMVGDQGSEKHKLEAKSPTDESP
EKKAFMAALGLRSTKDLQPPPAEEPVLDDNQAIQLETLKSGLPQEPGSTGLLTLSPLGAA
SLGASLTVLPPTKENMKHLSLQPFQKGFIIQPDSSIVVKPISSESAIELADIQQILKMAS
SVPPQISLPPLSKAPATPMQSIFKHMPPLKPKPLVTPRTVVATSTPPPLISAQQASPGCI
SPSLPPPPLRLIKTSAEAASNSQLLQPKSGAKLNSPSSQLFLQSRGDASGQPEMKTQLEQ
DSIIEALLPLNMEAKIKQEVTEGELKAIIAGAAGKKTPAMRKVLYPCRFCSQVFAFSGVL
RAHVRSHLGISPYQCNICDYIAADKAALIRHLRTHSGERPYICKICHYPFTVKANCERHL
RKKHLKATRKDIEKNIEYVSSNAAEMVDAFCSPDTVCRLCGEDLKHYRALRIHMRTHSGG
AAGCPKGRKPFECKECGTAFSTKRNCVHHVLKQHLHVQERDIDSYVLAVDCGVGPREPQA
PDAAALLEEAPYGDRKPLTAFLEPQNGFLRGAAQPPLPSHISIKLEPTSSFPMDFNEPLD
FSQKGKALALVQVKQENSFVGSSSYDCSMEPIDLSIPKTLRRDKEAAVLGEAKKPELGPG
CGDQLYSCPPPCPSLPVPLAASGPLEKPTASTAPSAATNSPGLPHPAQPLQAPLHLAVPI
ISPALLSNSALLRPLRPKPPPLLPKPPVTKELPPLASIAQIISSVSSAPALLKTEVSDPA
PKAASNPLLPEKPGGPKQKPAAISGTGSPKEPGESAVRAASPGAASPMEQGSAALSKKRG
RKKGTKNRPKTNSSSVDLESSGEFASIEKMLATTDTNKFSPFLQSAEDDVKDEAVPADPT
GPSDDEQDAPEEKLLRGKRNSYSACLQKISCPYCPRVFPWASSLQRHMLTHTGQKPYPCQ
KCDAFFSTKSNCERHQLRKHGVANCSLRRNGLIPQSKESDVGSHDSTDSQSDPEIPVTGG
EVLDLTSKEREPPPSEGAQEHSQDTQGHPADEGKEEKAPSPEGGQDPPPEEDADEEREAV
EERPEDMEGPEDDTVSNKSLDLNFASKLMDFKLAESEHTVPAGGGSSEQDKKHACDVCGK
SFKFAGTLTRHRKAHAHEEPRDERAPEEEAASPSATEHEDSPAEPKAAESPCGGRDNEES
ESISEGEGAADRKSSEKSDDDKKPKTNGTKSASKADKRKKVCTVCNKRFWSLQDLTRHMR
SHTGERPYKCQTCERTFTLKHSLVRHQRIHQKVKNTRHHGKESDKEDRGEDDSENESIHS
GNNPLSENEGDSAPNLNSHSAVTRSRRENLAGVAKDLSRQEDKSGGRTPGACLAEPNKSA
QKPAPAGTTEQESQGSADCESPSGFIQDLLDVHSKRPPANHILASAESAPPLVGME
Download sequence
Identical sequences F6VCC6
ENSMODP00000012384 XP_007488064.1.35504 XP_007488065.1.35504 XP_007488067.1.35504 XP_007488069.1.35504 XP_016287267.1.35504 XP_016287268.1.35504 ENSMODP00000012384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]