SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012426 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012426
Domain Number 1 Region: 406-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.23e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 574-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.38e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 323-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 267-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.39e-22
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 6 Region: 462-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.71e-21
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 47-108
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.37e-21
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 8 Region: 620-672
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.62e-20
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 9 Region: 370-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000257
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012426   Gene: ENSMODG00000023589   Transcript: ENSMODT00000012652
Sequence length 681
Comment pep:novel chromosome:BROADO5:3:504027601:504242793:1 gene:ENSMODG00000023589 transcript:ENSMODT00000012652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGTSFTVSALGKVSGTHTGSLPPLGSATPEGPQGGPSKEPEARGMSPSQGTIAFKDVAV
DFTQEEWCLLDHSQKELYLEVLLENVQNLFSVGLPVTREQLISCFQQGKAPWLLEQKGPR
SSSLDFEVKEVSAKLSHFVEGTGPQRCMNEVAHDFIFSEICNATIKEIKNPKTDYEFDET
ATKFSQYTVLNQYIKFTLGNDCCHDSKHRKCFPEEVGLVQSPEKPEMPMYQGNVGGMAFG
WSSDLIRHAKNKGVKIHSVSDNGGRPFNQNSEFAAHQRIYTREKPYDCKQCGKAFTEKGS
LAAHQRIHTGEKPYECKHCGKFFRQRGSLTVHQRIHTGEKPYECKHCRKAFTWKDSLVAH
QSIHTGEKLYECKNCGKAFTRRASLAKHQNIHNEEKPYECKQCGKAFKEKGSLAAHQRIH
TGEKPYECKHCGKFFTQRSSLAKHQRIHTGEKPYECKQCGKAFTLKYSLFAHQSIHTGEK
LYDCKQCGKAFTCRASLAKHQSIHIGKKPYECKQCGKAFKDRCHLAAHQRIHTGEKPYEC
KQCGKAFKERGHLATHQRIHTGEKPYECKHCGMAFLWMDSLVAHQSIHTGEKPYECKQCG
KAFTRRGSLAKHQSIHTGEKPYECKQCGKAFTLRSNLARHQKIHTGEKPYKCKQCGKVFT
WKESFSRHQTIHTEEKLYCRG
Download sequence
Identical sequences F6R8Y8
ENSMODP00000012426 ENSMODP00000012426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]