SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012514 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012514
Domain Number 1 Region: 77-108
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000762
Family CHHC finger 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012514   Gene: ENSMODG00000009996   Transcript: ENSMODT00000012742
Sequence length 369
Comment pep:known_by_projection chromosome:BROADO5:3:336851686:336876540:-1 gene:ENSMODG00000009996 transcript:ENSMODT00000012742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPPLRACKRLAPPNAVMETTPGVEPSPLEERQHLQQELSDFVETCYKTLEEVTTSLGW
SLDELNLGEGDSEDQNETVVCPYDSNHHMPKSSLVKHMASCRLRKLDYTKEEEAEMYDSA
FFYGNAKIPVVHLDKHLQFQILKQARASSGRDGDLYSQRIYSSVPIEVPQNHKRFICDLT
QADRHAIFDYVLEETKKQRSRSQITENDSDLFVDLAAKVNQDDSQKGPKSHLEILAEMRD
YKRRRQSYRAKNVHITKKSYTEVIRDVISVHMAELSSHWQEEVEQAEDDAENASSSAKSS
GRKEERRSASVDSRQSLESHKDADHSRHRRDRSRSPRKRKRSKEKERDRDLRRKRDRDEE
RHHGHKRRK
Download sequence
Identical sequences F6USA8
XP_007488048.1.35504 ENSMODP00000012514 ENSMODP00000012514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]