SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012524 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012524
Domain Number 1 Region: 6-66
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-26
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 2 Region: 497-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-25
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 3 Region: 141-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.32e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 609-666
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.74e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 277-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.79e-23
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 6 Region: 441-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 385-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.59e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 8 Region: 553-610
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.29e-21
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 9 Region: 655-707
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.49e-19
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 10 Region: 319-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.53e-18
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 11 Region: 187-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 12 Region: 722-774
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-16
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 13 Region: 104-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000249
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 14 Region: 225-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000541
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000012524
Domain Number - Region: 763-805
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0615
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012524   Gene: ENSMODG00000010002   Transcript: ENSMODT00000012752
Sequence length 805
Comment pep:novel chromosome:BROADO5:1:715306635:715311393:1 gene:ENSMODG00000010002 transcript:ENSMODT00000012752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQIFLVFQESMTFKDVAVEFSWEEWGHLNPSQKKLYRHVMLENYRNLVSLGFAVSKPDVI
YRLERKEAFWRPEADILRNCPGKAGLVTFLFLFSENKEFNGDNPYEYSEHTKAFRSSEHR
AVHQRIHAAEFFYECKECGKTFHWNAELIRHKRIHTGEKPYECTECGKAFNMKANLTRHQ
IIHTGKKPYECNECGKAFRQKIQLYVHQRIHTREIPFECKEYRKTFLCNSELFEHQRIHA
REKHECSKCGKTFKSNIKLNVHQRIHTEKNHECEKCTSHFNQSQRIHTGEKPYECSECGK
AFRRKSQLIVHQRIHTGEKPYECSECGKTFRLKAHHTRHEGMHTGEEPYECSECGKTFRS
KIQLTMHQRIHPIKICYECKECGKAFHHNTDLVKHQKIHNGEKPYECSECGKAFRRKAHL
TVHQRIHTGDILYKCKECDKAFLYNSAFIIHQRIHTGEKPYTCSECAKAFRSKTLLTVHQ
RIHTGEILYKCRECGKTFAYNSELIRHQRIHTGEKPYECNLCGKVFRRQQHLTVHLRIHT
GEKPYKCSECGKAFRRKTELTVHQKIHAGDILYECKECGKAFPYNSAFIVHQRIHTGEKP
YTCSECAKAFRSKTLLTVHQRIHTGEILYECKECGKTFPYNSELIRHQRIHTGEKPYECS
VCGKAFHRTVHLTRHQSIHTGEKPYRCNYCGKTFRLKIQLTQHQRIHSKRNLKSIMHMGS
HLDLIQHDSIHTRERSYECNEHGKSFILRKHLPQHQRIHVGEKPFLCNPCGKAYRPRTVG
HERIHNRFLMSVERPLSCLACGSEF
Download sequence
Identical sequences F6URV1
ENSMODP00000012524 ENSMODP00000012524 13616.ENSMODP00000012524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]