SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012585 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012585
Domain Number 1 Region: 399-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.57e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.32e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 455-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.6e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 5 Region: 232-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.23e-22
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 
Domain Number 7 Region: 511-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-19
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 8 Region: 553-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000096
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012585   Gene: ENSMODG00000010049   Transcript: ENSMODT00000012813
Sequence length 603
Comment pep:novel chromosome:BROADO5:Un:42304603:42322231:1 gene:ENSMODG00000010049 transcript:ENSMODT00000012813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRTQRPPSQGSITFKDVAVNFTQEEWCLLDHSQKELYREVMLENVQNLLSMELPVHRE
DFISCFQQKESLWLLEHKGPKSSCPEAEANFEVKEMSAKLSLFVEGFGPQRYMNEDPCYF
ILREMYDSNIKVNKNPKSDCECEEPAEKFSQYSVLNRYIKLNSRNDCWQDSEYSKCFPEE
VGFIQSPKKPEMPTYQGNPGGMAFGWSLGLIRYPKSKCVEVLSVSNKGGKPFSQNSELGS
HQIVHTGEKPYECKHCGKAFTVMGSLARHQIIHTGEKPYECKHCGKAFIWRGDLDKHQRI
HTGEKPYECTQCGKTFTERSNLAKHQRFHTGKKPYECKHCGKAFIWRGDLDKHQRIHTGE
KPYECTQCGKAFTERSNLAKHQRFHTGEKPYECKQCGKAFTVKNNLAEHQRIHTGEKPYE
CTQCGKAFTRRGDLALHQRIHTGEKPYECKQCGKTFTRRGPLTEHQRIHTGEKPYECKQC
GKAFIRRGNLDKHQTIHSGEKPYECKQCGKAFTRKDHLAVHQRIHTGEKPYEFKQCGKAF
THRDNLAVYQTIHTGEKPYECNHSKLTPCRRTFSQRSSLISYQRLHSAEKPNKCAQVVHV
FLR
Download sequence
Identical sequences H9H6D0
ENSMODP00000012585 ENSMODP00000012585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]