SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012726 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012726
Domain Number 1 Region: 510-706
Classification Level Classification E-value
Superfamily PUA domain-like 8.7e-39
Family LON domain-like 0.008
Further Details:      
 
Domain Number 2 Region: 189-314,438-464
Classification Level Classification E-value
Superfamily TPR-like 2.88e-23
Family Tetratricopeptide repeat (TPR) 0.0039
Further Details:      
 
Domain Number 3 Region: 89-132
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000303
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 4 Region: 153-163
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000889
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012726   Gene: ENSMODG00000010165   Transcript: ENSMODT00000012958
Sequence length 714
Comment pep:known_by_projection chromosome:BROADO5:X:27459520:27483460:1 gene:ENSMODG00000010165 transcript:ENSMODT00000012958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLTPESLEILQQADALATSGSLHQAFELYQVLYQRRQLMPEHLDTLVRCLAESIRNREGF
LEDDEDEEDDEDEEEEMEELAAEAAKYLAPWDGFLCRKCLGFLADPVSLTCGHTFCKVCL
EKERPCTLCCVPGSAVSEVPGCSGASSSGSVPPPPPPPPPPPPQPVPPMPRLRVNVLLSN
LLTKWFPGPTQASRLRHEGNRLYQEHKPEQALEKYCEALDLAPNDFLLYSNRSQIHSILK
HPEAALHDADMACRLQPHWLKGHLRKGQALALLGNTAEALREFLFCVALDEDNVMVRTEA
AREEVQEEPNLPSCSGDKRQASTSQLKKKRQARVAQPKEEKKQVRVAQPKKRKAPAAQPK
EKKKQTPMTQPKKKRQASVTQPKKNSEVPRKIHKKDTLETRETDRSHNVPFQSFDPTDLD
CPLCMRLFYEPVTTPCGHTFCMKCLERSLDHNPKCPLCKEGLAECVSVRKCSKNLLMEAM
IAKYLPDDLKERRRIFEEEMAELSNSLSKNVPIFVCTMAYPTVPCPLHIFEPCYRLMIRR
CMETGSKHFGMCIGDSTRGFAEYGCLLEIRNVEFFPDGRSVVDSIGKRRFKVLRQSQRDG
YNTADIEYVEDQKVEGEEYLRLLNLHSSVYDQALAWFNSLQQALRSRILGHFGPMPPKDL
DPQVNPNGPSWCWWILAVLPLESRAQLPFLSMQSLKNRLNGIRRVLMFLASNQN
Download sequence
Identical sequences F6TAJ9
13616.ENSMODP00000012726 ENSMODP00000012726 ENSMODP00000012726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]