SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012914 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012914
Domain Number 1 Region: 365-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.43e-26
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 533-590
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.4e-26
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 3 Region: 11-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 4 Region: 477-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.12e-23
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 421-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.3e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 6 Region: 309-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 575-627
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.35e-20
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 8 Region: 271-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.88e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 245-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000172
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012914   Gene: ENSMODG00000010304   Transcript: ENSMODT00000013150
Sequence length 639
Comment pep:novel chromosome:BROADO5:3:509762840:509778704:1 gene:ENSMODG00000010304 transcript:ENSMODT00000013150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPDHLASRAHQESVTFQDVAVDFTLEEWHQLGPAEKELYREVMLENYGNLVCLGLVISK
PDVISQLEQGQEPWNLKEEVLSSSSAGEPEWETRTETKESTLKPGIFLEKSSQEKFTKDG
VCVSKLGESWEHPSKLERLEKNEEKNSRPVKIIQWEIPHKVRSHEFSQHGKKVNLGPVPV
SQQKTSVKKNLHNCDKQRKGYRQYSDLSQYNGISSKTFSKYNKNGQSFRNNSGLTENPVL
LYTGENYECKKCGKTYQWPSLVSSDIHNREKPYECIECGNAFHRVTTLTDHQRVLSGEKS
YKCDQCGKTFCRKRRLTRHQRLHTGKKSHKCNECEKAFFKSKDLIRHQRIHTGEKPYECN
ECGKTFRQSIHLIQHQRIHTGEKPYECDTCDKAFRRKTGLIEHQRIHTGEKPFECNICGK
AFIRSPQLTVHQRCHEREKPYECNECGKTFCQRVQLTQHQRIHTGEKPYECKECGKTFYQ
KTVLTRHQRIHSGEKSHECSECGKLFWDSAQLTQHQRVHSGEKPYRCNECGKAFHRGTHL
TQHQRIHTGEKPYKCNECEKAFSQSTQLIQHQRIHTGEKPYKCNECGKAFRQSPHLIQHQ
RVHTREKPHKCNECGKAFCRRKELTRHEAIHSANKILSV
Download sequence
Identical sequences F6SSA7
ENSMODP00000012914 ENSMODP00000012914 XP_007490428.1.35504 XP_007490429.1.35504 XP_007490430.1.35504 XP_007490431.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]