SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013040 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013040
Domain Number 1 Region: 519-599
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.11e-17
Family Canonical RBD 0.00041
Further Details:      
 
Domain Number 2 Region: 412-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000725
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000013040
Domain Number - Region: 1159-1196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00286
Family HkH motif-containing C2H2 finger 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013040   Gene: ENSMODG00000010399   Transcript: ENSMODT00000013278
Sequence length 1229
Comment pep:known_by_projection chromosome:BROADO5:1:100989636:101232215:-1 gene:ENSMODG00000010399 transcript:ENSMODT00000013278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLVAAMSQEPETSGREQPDRDARTLAAAATAAPPGLLGPPGHRGMQQPLLPPPLPPPPP
APQAALPQILQNAAKLLDKNPFSVSNPSPLLPSPASLQLAQLQAQLTLHRLKLAQSAVTS
NTAAATVLNQVLSKVAMSQPLFNQLRHPSVITTPHGHAGAPQHPAVMPNARFSSRGITFS
PPSQGQGLGPSMNLPNQATNAMVMHPFTGVISQTSTQPAVVLGISKTGPVPAVAGFYEYG
KTTSTQGYGSDAETQSSFLPTSGAPSVGVTYEGHCSHTGHPKQDGQSTFPKDFYGPNSQG
QHMTGGQSLGFPGEQHMNTSSTGGSKGEVDPLLHGTASNNQWEWPPLSQSYELYDPEEPT
PDTKFGPSTPTPFNKKQNFSSTQRRGKEESMLSVRPLQAHELNDFHGITPLHLPHICTIC
DKKVFDLKDWEQHVKGKMHTQKCMTFSESAGIRCVVGSAEGALCTSPNSTAVFNTTGTED
FASNIGSSFAVVPTRSFAQSNPTFSPTASGTNFSQRKATAGRVVHICNLPEGSCTENDVI
NLGLPFGKVTNYILMKSTNQAFLEMAYTEAAQAMVQYYQEKSAVINGEKLLIRMSKRYKE
LQLKKPGKNVAAIIQDIHSQRERDLFREADRYGPERPRSRSPVSRSLSPRSHTTSFTSCS
SSHSPLCPSRADWGNGRESWDQSPYARREEERDLTHWRENGDDKRDRTDTWVHDRKHYPR
QLDKTDLDSRIEGMRGHRDKYVRPASPSTLHSSSSYKGREDGYYRKDPKLKPDRYLKQQQ
DSPVKSKKKEEIRLRERYPYCEDSGKGDVLEPKDNRTSENAKVKQSEKNKATKPDRSQEK
DADTEENKAAAEAEPGKEEEETLEESSQIVKIEDPDTANERKEKEQDWESGSEVEGESWY
PTNMEELVTVDEVGEEEDFIMEPDITELEEIVPVGQKDKTCPELFPCGMTPLDLNTDHGE
LAKEAGESIPDGAAEIRLETDRESAVSKSHSDEIGLEEQTCLNLNTEKKPAESEEDSFPK
DPNCHKKEEKATENSDVPLVPTSQKMSSQEPPEEGGAQSVLLLDDYKLMGSPKNETQEGS
KPEEKPSSHKETSNQSQACQEMLTEENSRFTEIQSLEMSSLAYSEMEMKQPHPLPSWEPE
DVFNELSIPLGVEFVVPRTGFYCKLCGLFYTSEETAKTSHCRSSIHYKNLQKYLSQLAEE
GLKSKEQGSSPKPDDCSIGIVPHFERKKL
Download sequence
Identical sequences F7A7C5
XP_007479091.1.35504 ENSMODP00000013040 ENSMODP00000013040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]