SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013187 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013187
Domain Number 1 Region: 215-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.66e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 382-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.3e-26
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 270-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.31e-25
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 326-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 10-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 6 Region: 176-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 428-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-19
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 8 Region: 133-187
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.47e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013187   Gene: ENSMODG00000010524   Transcript: ENSMODT00000013429
Sequence length 483
Comment pep:novel chromosome:BROADO5:7:64715291:64750886:-1 gene:ENSMODG00000010524 transcript:ENSMODT00000013429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAKLSLGRLQEVVMFKDVAVDFTQEEWPLLAPPQKELYKEVMLENAQNLLSVGLPVPLD
DVISYLEQRETPWMLEQEVTSGLCALCSNLLEQHLISLKKKIFYALNKCKRKQKFMSDGL
DNLAWREFCIEFQNSSLPEHQRMISEGKSHECNQCEKTFMHRSNLDVHQRIHTGEKPYEC
KLCGKAFSQTSTLASHLRIHTEEKPYECKQCGKIFSHSSVLAIHQRIHTGEKPYKCKQCG
KAFSQTSGLAVHQRIHTGEKPYECKQCGKTFTAISSLVHHQRIHTGEKPYECKQCGKKFS
QTSTLDSHQRIHTGEKPYECKQCGKTFSHSSVLAVHHKVHTGEKPYECKQCGKAFSQTSG
LASHQRMHTGEKPYECKQCGKAFSQISTLASHQRIHTGEKPYECKQCGKTFSQTSGLASH
QRMHTGEKPYECKQCGKAFSRTSGLASHQAMHTGEKPYECKQCGKTFSRTSGLASHQTMH
TGE
Download sequence
Identical sequences F7DQJ4
ENSMODP00000013187 ENSMODP00000013187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]