SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013204 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013204
Domain Number 1 Region: 233-277,506-586
Classification Level Classification E-value
Superfamily SET domain 2.24e-20
Family Viral histone H3 Lysine 27 Methyltransferase 0.062
Further Details:      
 
Domain Number 2 Region: 73-167
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000871
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 
Domain Number 3 Region: 291-335
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000000148
Family MYND zinc finger 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000013204
Domain Number - Region: 639-765
Classification Level Classification E-value
Superfamily TPR-like 0.00152
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013204   Gene: ENSMODG00000010537   Transcript: ENSMODT00000013446
Sequence length 795
Comment pep:known_by_projection chromosome:BROADO5:2:517304895:517336022:-1 gene:ENSMODG00000010537 transcript:ENSMODT00000013446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLPVEEWQSHVHRRWLQLQPSVQTSFSRTDADALWEIVLHCSALLQPEDEELLQRLAEG
YTVEKDPDAYLFYKEEGNREFQKKAYKAAAILYSKGTCHAKPNTQEMSLCFANRSAAFFH
LAQYETCLEDIGRAQMHGYPEGLWPKLMLRKAECLMALGRRQEAALTLCDLEQNVSAQQA
GTEALQRRLSHLKIRVQEDPDPAQAHPISLAQTSKEACPKAKNNWIPNASSSVSLCSDPS
RGRYLVATEDILPGELLVKEEAFVSVLNPGETSWLRSDPGAKWNCRVTTGDLHCHRCLKP
VWATIPCQGCSYARYCSQQCMQQAWECYHRTECSLGGTLLALGVFCHVALRTVLLAGLEV
VGKLVKTFQGTVNAQGRTPVETPDVPAILRRDQTNSLSKMPIPGCDKDGTYQSAYYALFH
LLPHTKKHSPEHKFLCGLSVLALCKKLGEAAQPSPWATQGPCEPKAEMSGPSAWAVAMLR
HVLQLHCNAQGVTALQETASEGDLITERRQVRLATGFFPVISLLNHSCRPNTSLSFRGSV
GIIQASRLIAQGEEILHCYGPHECRMDVTTRQQKLRSQYFFDCHCQACQNEEVCPVSTAP
KPSGFRCPSCKAALQGDDFLCCDNRTCTASASRAQLEHQVQDLQQQVKAALELLRDDRSA
QAIQLLLGCQQDAENFLSSEHMLMGEIEDHLAQAYASLGDWSRSAAHLQKSLLVVEARHG
PASVELGHELFKLAQVLFNGFAVSKALCAIEKAEKVLSIHYDPENEQMQELQQMKACLLE
LPGLPEGPTHGHVGK
Download sequence
Identical sequences F6ZF19
XP_007485819.1.35504 XP_007485820.1.35504 ENSMODP00000013204 ENSMODP00000013204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]