SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013217 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013217
Domain Number 1 Region: 409-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000416
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 2066-2114
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000826
Family Classic zinc finger, C2H2 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000013217
Domain Number - Region: 955-983
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000381
Family C2HC finger 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013217   Gene: ENSMODG00000010547   Transcript: ENSMODT00000013459
Sequence length 2251
Comment pep:known_by_projection chromosome:BROADO5:3:329627428:329804908:-1 gene:ENSMODG00000010547 transcript:ENSMODT00000013459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRTKQIHPRNLRDKIEEAQKELNEAEDSHKEILETGVKGTTDTVIGVKRKKIVNENHLK
KIPKSPLRNPLQTKLKENTGESSFNVLHRTSEYQKEENQIPIENGKQFTKQNGETLTVTT
KASKAETSVPPKKLSLSQHSLELRKWRSEGSDLGEFNLPGEQCVSSSMSSMTKTDNSECM
TFNCKTTSSSYTSTAFDVLLKAMEPELSTLSQKGPSCAIKVEKLRPNKVARSPSKLKNSQ
SASDHSLSHQEFVPDSQVSPCTSQTVHVSAAGKDEQTPIQTVSPSHTLHEQFISKSSQHN
QQLSVCPEGFTRSFTHQQSQDNPHIPHVYNIAVTPSASHTPPSNVSQVIPQNQPVDSSSP
MSVNPANSTQLPIAPMYNSAQVASIVNHSVEQMYNLILKDQKPKKQGKYICEYCSRACAK
PSVLLKHIRSHTGERPYPCVTCGFSFKTKSNLYKHKKSHAHAIKLGLVLQPDSSGLFLSH
ESNKALNIHSDVEESGESDDEGTADERQDDQGSIELESTQIMKIISNSETLQKSSSLPSN
PDHVLGDFSLQENSSDSQGRTALPKVVVHPVNISPLRAESPKITDSTSELPNTPKQRDIQ
VTNTKSNSDIVSSSETDDKLHQKGDITQLEERQAFHVGTIHAHYKGSRLLMSPEHKESIC
ESSKLGSTDSGYFSRSESTDQTMSPPPPFARVLPSTEKDPNKNNGPYTAPVTTAPPSAAQ
TASGEKAFVLSAQMRPPMATKTLEERISKLISDNEALVDDKQLDSVKPRRTSLSRRGSID
SPKSYIFKDSFQFDLKPIGRRTSSSSDIPKSPFTPTEKSKQVFLLSVPSLDCLPITRSNS
MPTTGYSAVPANVIPPPHPLRGSQSFDDKIGSFYDDVFVSGPHSSVQQSGHPRTLVRQTA
IEDSSSSENHVLGTTQSSDEGYLGCNVSNETLLPRSKSFAQGSNLEKKKSHQGRGTMFEC
ETCRNRYRKLENFENHKKFYCSELHGPKTKVAIREAEHSPGPNSTQPPVLHYRMAGSSGV
WEQAPQIRKRRKMKSVGDDDELQQNESGIVSKSLEGIQCQNISGSTSLSKHNVNTSGKQS
GCITLQKSQIQLVTRGIEQTTEPKLSPIIEKQINSGMLEKIELKRQGTGNSVIQHTNSLS
RPISFEKFEPFERSPPISFQEGNRSMKHGPLKTIKIIQEDGCIPGSTVHHPQLVLSDSPR
VEFQGSPRVVSNERNLLIQSRLVRQHNIQVPEILVTEEPDRDLEIQSNGQEKTEKFNWPQ
RSETLAKLPTEKLPPKKKRIRLAEMEHSSAESSFESTLSRSLSRESSLSHTSSFSASLDI
EEVSKIENTSKVESINKSELLMIPAGSQTLSVPGTPYREMRRAASEQINCTQPSMEVCDF
RSKSFDCGNTSPSKSIPLVEVQTLKSPTGFGITGHVPLLERRRGPLVRQISLNIAPDSHL
PPVIPSSFQNTLVSDITTVTFHRSQISSKSLNEFPANSLLSQIQVKDLEPAISTSISTIP
QQLLGNSLINQINFNPEHQNVQTSFGVTTQGKESDTASTKPLISESEDCFAPKYQLHFKT
LHSSQSCSNSINALSNQVLPNIVSVDQSLTSLKIPTKVVANTCSSCLLPALKHLCGQIQK
VSPFVVPVHIHSNAPPHSLATVTSLPQILVTQDQSNQPVCKANKVTVSTLESTIQMPKSH
QDHQNALPNPQKQLVHENVFSEIGQSSSLSESSTIIQKIPVSGLFPHPEVTASSKRMLSP
ANSLDIAMEKQQKRAKDENGAVCITDIRSLQLLNKKISDSNKHKKPVLVRQVCTTEPLEG
VLLDQEIIPQPGSSRDAGSLTDGILVNTSSGNKSIVEHIKNCQIENIKSSISPNLASRKS
APENIHISSLKSTNSIQERNSPVIKNKCNKMNIQELTTSSSFHSGDIQQLSFPSLKTTTS
FTWCYLVKRKPLHLPQNDQKTSAYSVWNISSSNPNPLGLPTKVALSLLNSKQKFGKSLYS
QAITTHSKSDVLVYSSKWKNNLSKRALGSQKSKVVEFSNKDTSEISNEQDKENSIMKNEP
RRVKIFDGGQSNEDYVYVRGRGRGKYICEECGIRCKKPSMLKKHIRTHTDVRPYHCNYCN
FSFKTKGNLTKHMKSKAHGKKCVDLGVSVGVIDDQDPEELGEKQRFGYEQSGYDIEDSDG
PDDDENENEDDDEDSQSESVLSAAPSVTASPQHHPTRSSLQESLSADEEIRIAECFSKVP
SDPMDALPKALPTKMTVLSSVQSDCRSSRSP
Download sequence
Identical sequences F6YRY9
ENSMODP00000013217 ENSMODP00000013217 13616.ENSMODP00000013217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]