SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013261 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013261
Domain Number 1 Region: 172-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000159
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 2 Region: 210-257
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000221
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013261   Gene: ENSMODG00000010584   Transcript: ENSMODT00000013503
Sequence length 264
Comment pep:known_by_projection chromosome:BROADO5:1:747623447:747795682:1 gene:ENSMODG00000010584 transcript:ENSMODT00000013503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPAVPSEHLPSLYGFSALHAVHLHQWTLGYP
AVHLPRSSFSKVPGAVSSLVDARFPLPAFPWFPHVIQPKPQDGGTGGPPLKAKPRFDFAN
LALAATQEDPSKLGHAEGPGSPPPGLSALLDVTKLSPEKKPTRGRLPSKTKKEFVCKFCG
RHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFC
QSRTLAVHKTLHTQVKDLKVNKIT
Download sequence
Identical sequences F7GHT5
ENSMODP00000013261 13616.ENSMODP00000013261 ENSMODP00000013261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]