SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013312 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013312
Domain Number 1 Region: 422-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-24
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 590-647
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 478-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 534-591
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-23
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 5 Region: 338-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-23
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 6 Region: 254-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 7 Region: 59-117
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.42e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 8 Region: 198-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-20
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 9 Region: 302-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000111
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 386-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000152
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013312   Gene: ENSMODG00000010628   Transcript: ENSMODT00000013557
Sequence length 649
Comment pep:novel chromosome:BROADO5:4:409004993:409026622:1 gene:ENSMODG00000010628 transcript:ENSMODT00000013557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQPWAKSASEPRGACVGAARAGVEGPSGLGAAEWPGPPGARAQAQGEVEVAWPAPACQ
QLMTFKDVTVDFTQEEWDHLGPAQRDLYKDVMLENYQNFLFLAGFPISKPEVISQLEIDE
ARWLMLVKEIPRNFSPVTGSRVYIKGWKETGRVGRSQNSILYAILEAIENNSTLEESDFM
GESSMRRFPVNTNECGETFRQMEHLIIHQRTQTGEKSYQCNECEKAFSCNSGLSVHQRNP
TGEKSYQCNQCGKTFNYNSYLTVHERIHTGLKPYKCTECGKAFRERRYLTIHLKIHTGEK
SYKCNQCGKAFSQRGSLNLHQKIHTGEKSYKCIECGKAFISYSVLTIHQRVHTGEKPYKC
NNCEKAFRQRGHLTDHQKMHTGEKSYKCNECGKAFRDRGYLMIHQKIHTGEKSYLCNECG
KAFRERGHLTIHQKIHTGEKSYKCNECGKAFRQKGNLAVHQKIHTGEKPFKCNICGKAFR
DKGYLVVHQRIHTGEKPFKCNVCEKAFTDKGYLTIHLKIHTGEKSYKCNVCGKAFRDKGY
LAVHHRIHTGEKPFICNICGKAFTDKGYLTIHMKVHTGEKSYKCNECGKSFSSNSGLTMH
HRIHTGEKPYICNECGKAFRQRGTLNDHQRVHTGEKSYKCNECGKAFKE
Download sequence
Identical sequences F7DP31
ENSMODP00000013312 ENSMODP00000013312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]