SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013366 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013366
Domain Number 1 Region: 357-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-26
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 273-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.37e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 189-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 399-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.3e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 151-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-19
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 441-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000272
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 236-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000247
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 8 Region: 320-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000161
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013366   Gene: ENSMODG00000010672   Transcript: ENSMODT00000013611
Sequence length 485
Comment pep:known_by_projection chromosome:BROADO5:1:15087173:15099965:-1 gene:ENSMODG00000010672 transcript:ENSMODT00000013611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMWLGTSGRSGLSGPCPENPLQGCHPAGLEEWALNGISRPSVISQLEQKEEPWVLDLQSL
EEGEILREAHTDFENQVEKLNQEVSDTTEQFGPSLGKSPKDITQNPDWERKWEREHVLER
QHGPLTGEGQKELLSKERHLNKLLGRYVGGKPNVCAECGKSFNQTSYLMRHLRTHTGERP
YKCLVCGKAFKQSSDLVTHRRTHTGEKPYKCNGCEKSFGDSSTLIKHQRTHTGERPYECP
DCGKTFSRKPHLIMHQRTHTGEKPYKCLECQKSFSRSSNFITHQRIHTGEKPYTCNDCGE
RFSQSSDLVKHQRTHTGERPYKCPECGKGFRDSSHFVAHMSTHSGERPFSCPECDKSFSQ
SSHLVTHQRTHTGERPYKCDDCGKGFTDSSALIKHQRIHTGERPYKCGECGKSFNQSSHF
ITHQRIHLGERPYKCPDCGKSFNQRSHFITHQRTHTGEKPFQCTKCEKSFRQKAHLLSHQ
NTHLT
Download sequence
Identical sequences F7CJX4
XP_003339944.1.35504 XP_007478138.1.35504 XP_007478139.1.35504 XP_007478140.1.35504 XP_007478141.1.35504 ENSMODP00000013366 ENSMODP00000013366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]