SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013388 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013388
Domain Number 1 Region: 94-457
Classification Level Classification E-value
Superfamily ARM repeat 2.83e-105
Family Diap1 N-terninal region-like 0.000000000011
Further Details:      
 
Domain Number 2 Region: 756-1086
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 5.62e-100
Family Formin homology 2 domain (FH2 domain) 0.0000000000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013388   Gene: ENSMODG00000010684   Transcript: ENSMODT00000013633
Sequence length 1185
Comment pep:known_by_projection chromosome:BROADO5:1:333349203:333443850:-1 gene:ENSMODG00000010684 transcript:ENSMODT00000013633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DMEPPGGGLGPGRGTRDKKKGRSPEEPPAAGGGDGGKSKKFTLKRLMADELERFTSMRIK
KEKEKPNSAHRNSSASYGEDPSVQSLQDVSDEQVLVLFEQMLLDMNLNEEKQQPLREKDI
IIKREMVSQYLHTSKAGMSQKESSRSAMMYIQELRSGLKDMHLLSCLESLRVSLNNNPVS
WVQTFGAEGLASLLDILKRLHDEREESAGSYDSRNKHEIIRCLKAFMNNKFGIKTMLETD
EGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVDRFQPL
LEGLKSGTSIALKVGCLQLINALITPAEELDFRVHIRSELMRSGLQQVLKDLRLMENEDM
KVQLAVFDEQGEEDSYDLKGRLEDIRMEMEYPSTVYEVFQILLNTVKDSKAEPLFLSILQ
HLLLVRNDYEARPQYYKLIDECISQIVLHKNGADPDFKCRHLQVDIEGLIDQMIDKTKVE
KTEAKAIELEKKLDSELTARHELQVEMKKMENDFEQKLQDLQGEKQTLDAEKQQLASEKK
DLEAEVSQLTGKVTNLSKELEDAKKGMALLSAAVASPVPLAPSSDTVPPAPPLPSGINYY
FLQRLSSSPSFLTENSGIPPPSPLPLPGSTGIPPPPPLLGGPGIPPPLPGMCLPPPPPPA
FGGLGVTSAPALPYGLVPKKLYKPEVQLRRPNWSKFVAEDLSQDCFWTKVKEDRFEDNEL
FAKLTLTFSAQTKTSKAKKDQEGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPY
QEIKTVILEVNETVLTESMVQNLIKQMPEPEQLKMLSELKDEYDDLAESEQFGVVMGAVP
RLRPRLNAILFKLQFNEQVENIKPEIVSVTAACEEVRKSENFSSLLEITLLVGNFMNAGS
RNAGAFGFNISFLCKLRDTKSTDQKMTLLHFLAELCENNYPDVLKFPDELTHVEKASRVS
AENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFISLESNSFVKDAQEQYNKLRMMHSN
METLFKELGDYFLFDPKKITVEEFFMDLNNFRNMFLQAVKENQKRRETEEKMRRAKLAKE
KAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQANRKAGCAVT
SLLASELTKDDAMTTCSAKVSKISEGTRDIHDLRDENKELIGRAS
Download sequence
Identical sequences F7C147
13616.ENSMODP00000013388 ENSMODP00000031544 ENSMODP00000013388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]