SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013394 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013394
Domain Number 1 Region: 1-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.93e-25
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 
Domain Number 2 Region: 124-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.12e-23
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 290-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-21
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 457-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 402-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.79e-20
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 177-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-19
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 234-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-18
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 9 Region: 735-787
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-17
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 10 Region: 81-141
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 597-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.25e-16
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 12 Region: 514-576
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000378
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 13 Region: 687-747
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000445
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 14 Region: 781-827
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000146
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 15 Region: 646-681
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000057
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 16 Region: 839-890
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000128
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013394   Gene: ENSMODG00000023049   Transcript: ENSMODT00000013639
Sequence length 896
Comment pep:novel chromosome:BROADO5:1:714937039:714951215:-1 gene:ENSMODG00000023049 transcript:ENSMODT00000013639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQESVTFQDVAVEFTWEEWRYLNPSQKKLYKDVMLENYQSLISLGFEVSKPDVIHQLER
KETSWMPEADVSQSSYPEFTGEKPYECSECGNVFSSRTQLTMHQRIHTRKFLYECKECGK
ACHCNSELIRHQRIHTGEKPYECTVCGKAFSMNGNLIVHQRIHTGEKPFECSECGKSFRQ
RTHLYVHQTVHTQEISHECSECGKAFMRKTQLAVHQRIHTGGRPYGCSVCGKDFFCSSDL
IKHQKIHIIEKSYECSECGKVFRSKIQLTVHQRIHPGKSLYECKECGKEFHCNSNLIKHQ
RIHTEEKPYQCNDCGKAFRRKAHLTLHQRIHTGDILYGCQECEKTFLYISDLTRHQRIHT
EEKPYECAVCVKAFRSKTQLSVHQRIHTGEKPYECTECGKFFRQRSHLYIHQRIHTVDIL
YECKECGKAFPYNSDLIQHQKVHTGEKPHECTVCTKAFRSKTQLTVHQRIHTGEKPYECT
ECGKFFRQRTHLYIHQRIHTGEILPYECNKCGKTFRLKTQISQHQRIHSGKNLYECNACE
KAFRLRTHIYIHQRIHNLRGFTGELLYECNEYGKAFRLGTQLAQHQRIHPGEILFEGKKH
ECCECGKVFKKKAQFTGHQRIHTGESPYECSEHGKLFKKKAYLTQHQTIHTGEKPYKYNK
CARAFILRQLLTQHQTLHTGEQCGKAFRLGTQLSKHQRIYPGENFMNNPYEYSESGKTFH
YNSEFTRHQRIHTREKPFTCTVCGKNFCLTKIHTGEKPYKCNKCGKTFLWNADFMQHQSI
HTVEKPYECNECGNAFCQMVELTHHKRIHTGEKPYEHNDCGRVFRNSGKESYKYNQKIHS
GEETYKCAECRKAFRMGKQLQNQRIYTKEKDYGHNHCGEAFRLKKQLTRHQRIYLG
Download sequence
Identical sequences F7C0P9
ENSMODP00000013394 13616.ENSMODP00000013394 ENSMODP00000013394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]