SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013395 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013395
Domain Number 1 Region: 1065-1277
Classification Level Classification E-value
Superfamily SET domain 2.09e-71
Family Histone lysine methyltransferases 0.0014
Further Details:      
 
Domain Number 2 Region: 949-1080
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.9e-28
Family PWWP domain 0.00000289
Further Details:      
 
Domain Number 3 Region: 259-420
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.01e-27
Family PWWP domain 0.0052
Further Details:      
 
Domain Number 4 Region: 1299-1368
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000266
Family PHD domain 0.0036
Further Details:      
 
Domain Number 5 Region: 915-966
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000171
Family PHD domain 0.0039
Further Details:      
 
Domain Number 6 Region: 688-744
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000208
Family PHD domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000013395
Domain Number - Region: 748-805
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00787
Family PHD domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013395   Gene: ENSMODG00000010691   Transcript: ENSMODT00000013640
Sequence length 1439
Comment pep:known_by_projection chromosome:BROADO5:1:572909811:573020870:-1 gene:ENSMODG00000010691 transcript:ENSMODT00000013640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFSFSFMQGIMGNTIQQPPQLIDSANIRQEDAFDNSSDIVEDGQTPYETSLQQGFQYPP
TTEELPPITNGYPPSISMYEPQAKYQTYSQYPNGSANGFGAVRNFSPTDYYHTEISNTRP
HEVLEKPSPQQPPPPPSVPQTVIPKKTGSPEIKLKITKTIQNGRELFESSLCGDLLNEVQ
ASEYAKSKHEGRKEKRKKSNKHDSSKSEERKSHKIPKLEPEEQNRPNERVNVLSEKPRED
SMVLEETPVQQYLPSLPAEVSTGVKFQVGDLVWSKVGTYPWWPCMVSSDPQLEVHTKINT
RGAREYHVQFFSNQPERAWVHEKRVREYKGHKQYEQLLAEATKQASNHSEKQKIRKPRPQ
RERAQWDIGIAHAEKALKMTREERIEQYTFIYVDKQPEEVLSQAKKSAASKTEVKKNRRP
KAVLNTQPEQSNAGEAASSLPSTEIRRHSQRRHTSVEEEEPPPVKIAWKTAAARKSLPAS
ITMHKGSLDLQKCNMSPVVKIEQVFALQNAAGDGKFIDQFVYSTKGVGNKTEISVRGQDK
LIISTTNQRNEKATQNVSSPETTSGSTGSVEKKQQRRSIRTRSESEKSTEVVPKKKIKKE
QVETVPQTTVKTGLQKGASEISDSCKPLKKRSRASTDVEMTSSAYRDTSDSDSRGLNDLQ
VSFGKQLDSPSAAADADASDVQSVDSSLSRRGTGTSKKDTVCQICESYSDSLVVCEGECC
KHFHPDCLGLSSLPDGRFLCTECKTGHRTCFSCKIPGKDVKRCSVPACGKFYHEACVRKF
ATAVFESRGFRCPQHCCSTCSMEKDIHKASKAGRMMRCLRCPIAYHSGDGCIAAGSRCVS
SYLLICSNHSKRSNHSSSTINVGFCFVCARGLIVQDHSDPMFSSYAYKSHYLLNESNRAE
LKLPMIPSSSASKKKCEKGGKLLCCESCPASFHPECLNIEMPEGCWNCNDCKAGKKLHYK
QIVWVKLGNYRQREWWPAEICNPRSVPLNIQGLKHDLGDFPVFFFGSHDYYWVHQGRVFP
YVEGDKSFAEGQTSINKTFKKALEEAAKRFHELKAQRENKEALELERNSRKPPPYKHIKA
NKVIGKVQIQVADLSEIPRCNCKPADENPCGLESECLNRMLQYECHPQVCPAGDRCQNQC
FTKRLYPDAEVIKTERRGWGLRTKRSIKKGEFVNEYVGELIDEEECRLRIKRAHENSITN
FYMLTVTKDRIIDAGPKGNYSRFMNHSCNPNCETQKWTVNGDIRVGLFALCDIPAGVELT
FNYNLDCLGNGRTECHCGADNCSGFLGVRPKTAFASANEEKAKNAKLKQKKRKIKTEQKQ
MHEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWHQCDTCSNSAVSFC
EFCPRSFCKDHEKGALVPSTLEGRLCCSKHNPKSPVAPEYWNKIRCKLEPQDPGDEVKE
Download sequence
Identical sequences F7C0P2
ENSMODP00000013395 ENSMODP00000013395 13616.ENSMODP00000013395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]