SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013414 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013414
Domain Number 1 Region: 424-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 313-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 537-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 4 Region: 18-73
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.67e-21
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 5 Region: 368-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-20
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 579-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-20
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 466-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000144
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013414   Gene: ENSMODG00000027879   Transcript: ENSMODT00000013660
Sequence length 638
Comment pep:novel chromosome:BROADO5:3:521006981:521012651:1 gene:ENSMODG00000027879 transcript:ENSMODT00000013660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESLEECGEDAGLQPGKPAQASVKFKDVAVDFTWEEWRLLDPPQKELFWEVMLENYRNLV
CLDLADSNKDVMMSKLESGEPHWIPTGGVLRSCWPGWELRPQTKESAPKMNISVKVLTQE
KSLEDDPRICKMEKAWECDGRLKRKRSMEGKPSRGIKIIQAEPPSEAGGSDYGKYSQTSS
PEPGLFPQQGASVVMQGQKEDNQRGRSTRYLNQGQCDQIHSRKKCRKVKKCQNKVLGHDL
GCIKNRGILSEEKVYERGNSFPSINELGPHQRTDRETKCNELTKQRKTGRAEHYSHRQST
ERRYKCNECGKAFQEKGSLKKHYRMHTGEKPFKCSECGKAFCRSTSLTIHQRSHTGERPY
ECNECGKAFRSKSHLSEHWRTHAGTGLHKCHICGKAFYSKYNLTNHSRIHTGEKPYECSE
CGKTFRLKSSLTCHFRNHTGEKPFKCSECGKAFSRSTSLTIHQRSHTGEKPYECNECGKT
FPSNSHLSEHRRTHARTGVHDCKEYGKTFWSRSNPSDHRKSTHAGTGIHECNVCGKAFSK
KYNLTIHSRIHTGEKPYECSECGKTFRLKSSLTFHFSNHTGEKPFQCSDCGKAFSRSTSL
TIHQRCHTGEKPYECSECGKTFRSSSELSRHRRTHAGI
Download sequence
Identical sequences F7GH63
ENSMODP00000013414 ENSMODP00000013414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]