SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013461 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013461
Domain Number 1 Region: 440-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 271-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 523-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-26
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 9-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-25
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 5 Region: 579-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 6 Region: 327-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.57e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 7 Region: 383-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.87e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 8 Region: 621-673
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-19
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 9 Region: 233-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-18
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 10 Region: 486-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000789
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 11 Region: 193-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000635
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013461   Gene: ENSMODG00000010742   Transcript: ENSMODT00000013707
Sequence length 678
Comment pep:novel chromosome:BROADO5:4:409323511:409337608:-1 gene:ENSMODG00000010742 transcript:ENSMODT00000013707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSSLLTVKSEETVTFKDVAVDFTWEEWKQLTPVQRDLYRDVMLENYQNLVSLGLPVFQS
DLISQLERGEVPWIPEGETFRGPCPGSINQETICKIKGFTLKQDIFVGESSKERFTNNDA
WDSKLGEEWECNVRSGRQKDSQEEKYRRTIVTHKCQMFSSLSLGLDSFAQQMNAARKTLH
RDGMHDECLRPFSDLVKWNGISSGKKPYEYNKCKKTSYDSGLTQNHRKCSGKKQHECNEC
KKAFSYKGYLIEHKRIHTGEKPFKCNKCGKAFGSNSSLRKHQRIHTGEKPYECNECGKAF
INNSSLKKHQRIHTGEKPYECNECGKAFSHGGYLTEHKRIHTGEKPFECNKCEKAFSNSS
SFRKHQRIHTGEKPYECNECGKAFRSSSSFKKHLRLHSGEKQFECSECEKSFSNSSSLMK
HQRIHTGEKPFVCNECGKGFIQRGNLTEHQRVHTGEKPFKCNECGKAFSQRGNLTEHQRI
HTGEKPFKCNECGKAFGNNSCLLKHQRIHTGERPYECKECGKAFNNSSSLMKHWRIHTGE
KPYECNECGKAFTNSSSLLRHQRIHTGEKPYECNECKKAFTNSSSLMKHQGIHTGEKPFE
CDECGKAFSHKGYLTEHKIIHTGEKPFECNECGKAFNKSSSLRKHHRTHTGEKYFQCNKC
GKAFSKNSSLKKHQRVHI
Download sequence
Identical sequences F7FWV4
ENSMODP00000013461 ENSMODP00000013461 XP_016277892.1.35504 XP_016277893.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]