SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013523 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013523
Domain Number 1 Region: 329-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.9e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 442-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 497-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.09e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 553-610
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 385-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.3e-24
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 6 Region: 34-95
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.67e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 7 Region: 287-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.63e-21
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 8 Region: 609-663
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.02e-17
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 9 Region: 251-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000628
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013523   Gene: ENSMODG00000010794   Transcript: ENSMODT00000013770
Sequence length 664
Comment pep:novel chromosome:BROADO5:4:409450150:409472091:1 gene:ENSMODG00000010794 transcript:ENSMODT00000013770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDLALVIEERGLAFPDLSFPQGGAEEKEEELLSFQEPLKFRDVAVEFTQEEWGQLNSSQ
KNLFRDVMLENYKNFVYLGLPVSMPAMILLLERGEASWMSEEEAPGGILSDSISHETVFK
TRNTALKKGIFMGTSSKQRMAKADGSWNSNMGKMWKRDIMLENQKDNQERQSKQVTIAVR
KTFNEASVLEYNTFGRNFHLGSILVPQQRISTVRSLHNYDILGKSIKEFSDLIKCNKTIL
GKNLSKPLGYHSGLIQYQMINNKDKPFDYREYGKAFNQNVNLNKTVHTGEKRFECNECGK
TFSNNSCLTLHQRIHTGEKPFECNECGKAFSQKSNLTLHKRIHTGEKPFECNECGKTFSQ
KGHLIEHQRIHAGEKPYKCNDCGKTFSQRGNLNEHKRIHTGEKPFECNECGKAFSQRGHL
TEHQIMHDGDKPYKCNECGKEFSHRTSFIYHQRIHTGEKPYECNECGKTFSKNSNLTLHQ
RIHTGEKPYKCTECGKAFSQRGHFNEHQRIHAGKKPYKCSECGKAFSKNSNLTLHQRIHT
GEKPYECSECGKAFSKKGHLTEHQRIHAGEKPYKCNECGRAFSHKTTFINHQRIHTGEKP
YECNECGKAFSQRGNLTEHKRIHTGEKCFECNECGKAFTHGSSFIHHQRLHNGEKLHKRN
ECRM
Download sequence
Identical sequences F7CIA2
ENSMODP00000013523 ENSMODP00000013523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]