SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013634 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013634
Domain Number 1 Region: 303-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000576
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 2 Region: 335-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000221
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013634   Gene: ENSMODG00000010888   Transcript: ENSMODT00000013883
Sequence length 373
Comment pep:known_by_projection chromosome:BROADO5:X:71527369:71541853:1 gene:ENSMODG00000010888 transcript:ENSMODT00000013883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSCSSEVVPDELREVSPEPMLAGKKSHPEGSSVGDELDTSSSTPYSVNINVFLPESTHLC
SGFYGAPKTLAVFPQIKSEPSTSFVQACPAIVPSPATLPDFTSVFSAPQTMAVNNVSIKP
KLSGEMPGAAGVQPTLSCQMPVAGAGVGVSVSMAMPLASSATAFSGLNGITIAADSSLVG
MLQQPSKQKKEDKALPNSLQMQEAVSSTEQFCPAPRITGSPSLSSAHLSPNQPPLCGETA
FGLKFIRAPQIATFSAGLATLSQGHLIVQATKLSPNPGNNPEPDKKRVHRCDYPGCVKVY
TKSSHLKAHQRTHTGEKPYKCSWEGCNWCFARSDELTRHYRKHTGVKPFRCTICDRCFSR
SDHLSLHIKRHQN
Download sequence
Identical sequences F7FJE6
ENSMODP00000013634 ENSMODP00000013634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]