SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013650 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000013650
Domain Number - Region: 112-201
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0209
Family Formin homology 2 domain (FH2 domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013650   Gene: ENSMODG00000010902   Transcript: ENSMODT00000013900
Sequence length 232
Comment pep:known_by_projection chromosome:BROADO5:1:107556066:107565708:-1 gene:ENSMODG00000010902 transcript:ENSMODT00000013900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIPSDKTPALPATPKASETVAVSQSHSSGKQLMSATLRERLKKTRSSFNSCYALAKRVK
GDTEENNSTVSKRATSSSDGSCSGSSENCKNMEKAEESLCLKDPLKDVDVYRSESLELSG
LPDNLPVVSEGHSIGKKELLEEKMKLLKQVQEKEELLRRLKLTKMYRSKNDLSHLQSLIK
KWRNSSQLLLFELQSTLSVENKKLSLTQLIDSYGLEDQLLHYNRIEEEFTDF
Download sequence
Identical sequences F7FIV7
ENSMODP00000013650 XP_007479133.1.35504 XP_007479134.1.35504 XP_007479135.1.35504 ENSMODP00000013650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]