SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013655 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013655
Domain Number 1 Region: 45-136
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.37e-34
Family SCAN domain 0.0000675
Further Details:      
 
Domain Number 2 Region: 262-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-16
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013655   Gene: ENSMODG00000010904   Transcript: ENSMODT00000013905
Sequence length 305
Comment pep:novel chromosome:BROADO5:1:572045733:572046784:-1 gene:ENSMODG00000010904 transcript:ENSMODT00000013905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTEFREAASLTPGPPQEQKRPLKMELRMAGAWEKEPGLQWNVMPFDGEIFHQCFRHFCY
EETPGPHQALNQLRDLCQKWLKPDIHTKQILELLVLEQFLTMLPEELQAWLREHHPKSGE
QAVIMLEDLEQELDQPDQKEEILKESTSGTSQKSSCVQLQTLEVQFKCESPEPCIQPERG
GDNQTGISAENELYEEVSGNLNGNILQLSECDKHLKGRLRIKASILLKNSMAVMYVRKSS
VRVHIFLIIREFILERDPMRSSIHTGEKSFECGKSFNQSSSLIQHQRIHTAEKPYSCNQC
SKSFS
Download sequence
Identical sequences F7FIT9
13616.ENSMODP00000013655 ENSMODP00000013655 ENSMODP00000013655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]