SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013770 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013770
Domain Number 1 Region: 335-415
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.4e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 2 Region: 246-312
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000146
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 3 Region: 617-665
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000353
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000013770
Domain Number - Region: 26-37,508-523
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000706
Family Formin homology 2 domain (FH2 domain) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013770   Gene: ENSMODG00000011001   Transcript: ENSMODT00000014022
Sequence length 670
Comment pep:known_by_projection chromosome:BROADO5:3:75604224:75627365:1 gene:ENSMODG00000011001 transcript:ENSMODT00000014022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSGSSAALALAAAPAPLPQPQPPPPPPPPPLPPPPPGGPEPERDGLLLRERLAALGLDD
PRQADTTDPSLRAAVAAAQAQARRMVGLSPEERAHPGRPGAPETAGLELEEEEEEEEEEA
EVDGDLLEEEDLEEEDDEEEEDQDRPPLLLLSPPAAAATSQSHPIPGGSLGSVLLPTPGF
DAREAAAAAAAAGVLYGGDDPQGMMAAMLSHAYGPGGCGGAAAAAAALNGEQAALLRRKS
VNTTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPIFVVTGRKEDVAMA
KREILSAAEHFSMIRASRNKNGPALGGLPCTPNLPGQTTVQVRVPYRVVGLVVGPKGATI
KRIQQQTHTYIVTPSRDKEPVFEVTGMPENVDRAREEIEMHIAMRTGNYIELNEENDFHY
NGTDVSFEGGTLSSAWLSSNPVPPSRTRMISNYRNDSSSSLGSGSTDSYFGSNRLADFSP
TSPFSTGNFWFGETLPSVGSEDLAVDSPAFDSLPTSSQTIWTPFEPVNPLSGFGGDPSGN
MKTQRRGSQPSTPRLSPTFPEGIEHPLARRVRSDPPSTGNHVGLPIYIPAFSNGTNSYSS
SNGGSTSSSPPESRRKHDCVICFENEVIAALVPCGHNLFCMECANKICEKRTPSCPVCQT
AVTQAIQIHS
Download sequence
Identical sequences F7A143
ENSMODP00000013770 ENSMODP00000013770 XP_001362272.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]