SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013931 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013931
Domain Number 1 Region: 169-226
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.35e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 393-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.06e-26
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 3 Region: 281-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.44e-26
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 113-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.54e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 509-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-25
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 6 Region: 565-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 337-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-25
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 8 Region: 225-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.21e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 9 Region: 57-114
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 10 Region: 453-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.06e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 11 Region: 2-58
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 12 Region: 621-679
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-19
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 13 Region: 668-720
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-17
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013931   Gene: ENSMODG00000011130   Transcript: ENSMODT00000014186
Sequence length 722
Comment pep:novel chromosome:BROADO5:3:437379176:437408406:1 gene:ENSMODG00000011130 transcript:ENSMODT00000014186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NFKQNSDLVLHQRIYIGEKSYKCNECGKIFNRNSNLREHQKIHTGEKPYKCNKCSKAFIC
SSRLIQHQLIHTGEKPYRCDECGKAFSLNSQLNRHQKTHTGDKPFICNDCQKTFSQKSHL
LQHQRIHTGEKPYRCDKCGKAFGQNSQLILHQRIHTGERPHACNECGKAFNQRSLLIRHQ
RIHTGERPYKCNECGETFIQNSHLILHQRIHTGERPYKCKECGKSFSQNSTLDQHQIVHT
GVKPYKCNDCGKAFRWSSRLIQHQLIHTGEKPYKCNKCSKAFSCSSGLILHQRTHTGEKP
YKCNECGKGFIQSSQLIQHQRIHTGEKPYGCHECGKAFGQSSQLIQHQRIHSGEKPYGCD
KCGKAFSQRSQLTLHQRIHTGEKPHKCSECGKAFCQSSQLRLHQRIHTGEKPHKCTECGK
AFTQSSLLIRHQRVHTGEKPYECHECGKAFSQSFGRSSLLTRHERTCTGEKPYRCNECWK
SFSQSSHLIQHQRTHTGEKPYECIECGKSFIQSSQLIQHQRIHTGEKPYGCKECGKGFSS
SSHLTQHRRIHTGERPYGCDECGKAFSQSSHLILHQRTHTGEKPYVCMECGKCFSCSSHL
AQHQRIHTGEKPFECNECGKAFCLNSQLMRHQRTHTIEEKLYKCNECSRAFSQSSHLIQH
QRIHTGEKLYGCVQCGKAFSRSSNLIRHQATHISEKPFKCQQCGKAFIHSLQLSKHQRIH
TK
Download sequence
Identical sequences F7BAR9
13616.ENSMODP00000013931 ENSMODP00000013316 ENSMODP00000013931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]