SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013976 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013976
Domain Number 1 Region: 383-579
Classification Level Classification E-value
Superfamily Cyclin-like 9.86e-74
Family Retinoblastoma tumor suppressor domains 0.0000000189
Further Details:      
 
Domain Number 2 Region: 649-788
Classification Level Classification E-value
Superfamily Cyclin-like 4.19e-55
Family Retinoblastoma tumor suppressor domains 0.000000277
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000013976
Domain Number - Region: 22-31,79-92
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00366
Family Formin homology 2 domain (FH2 domain) 0.03
Further Details:      
 
Domain Number - Region: 62-141
Classification Level Classification E-value
Superfamily Cyclin-like 0.0476
Family Transcription factor IIB (TFIIB), core domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013976   Gene: ENSMODG00000011168   Transcript: ENSMODT00000014231
Sequence length 932
Comment pep:known_by_projection chromosome:BROADO5:4:320051560:320209429:-1 gene:ENSMODG00000011168 transcript:ENSMODT00000014231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAHQSVMPPKAPRKPAASTPEPPPPPPSPPPREEEPEPDSGPGELQLVRLEFEETEDPDF
TTLCQKLKLPNRVRKEAWENWEKVSSMDGVLEYDIQKKKELWGICIFTAAIDLDEMPFTF
TELQKNIDISVHKFYHLLREIDTSTKVDSTVSRLMKKYDVLFALYDKLERTCGLIYVAQP
SSPISSEINSMLVLKVSWILFLLAKGEILQMEDDLVISFQLMLCVLDYFIKLSPPAVLNE
PYTVSTSSINGSPRTPRRGQNRSARIARQPETDTRVIEVLCKEHECNIDEVKNVYLKNFL
PFLKSLGISASNGLPEVENLSRQYEEIYLKNKDMDARLFLDHDKTLQADSIYSFEVERTP
RKNHPDEEMPLIPPQTPVRAVMNTIQQLVMILNSASDQPSENLNSYFNNCTVNPKESILK
RVENIGRIFKEKFAEAVGQGCAEIGSQRYKLGVRLYYRVMESMLKSEEERLSIHNFSKLL
NDKIFHTSLLACAVEVVMATYGRNTYQSHDSGTDLSFPWILNVLDLKAFDFYKVIESFIK
AEASLTREMIKHLERCEHRIMESLAWQSDSPLFDLIKQSKEREGSVDHLLEPTSTLNMPL
QHNHTAADLYLSPVRSPKKKGSTARINSTSSAEPQTTPASQTQKAPKSTSLSLFYKKVYR
LAYLRLNTLCSRLLSDHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKN
IDLKFKIIVTAYKDLTHAIQETFKRVLIREGQYDSIIVFYNLVFMQKLKTNILQYASNRP
PTLSPIPHIPRSPYKFSSSPLRVPGGNIYISPLKSPYKFSEGLPTPTKMTPRSRILVSIG
ESFGTSEKFQKINQMVCSSDRLLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESK
FQQKLAEMTSTRTRMQKQKMNDSMDTSSKEEK
Download sequence
Identical sequences F6ZZR2
13616.ENSMODP00000013976 ENSMODP00000013976 ENSMODP00000013976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]