SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013987 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013987
Domain Number 1 Region: 360-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-26
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 2 Region: 276-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-25
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 3 Region: 563-619
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.83e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 220-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.85e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.98e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 164-221
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.09e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 712-767
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 8 Region: 1-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-21
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 9 Region: 627-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.49e-21
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 10 Region: 500-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-20
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 11 Region: 756-808
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-19
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 12 Region: 323-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000361
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 13 Region: 671-706
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000398
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 14 Region: 116-165
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000183
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 15 Region: 464-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000645
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013987   Gene: ENSMODG00000011178   Transcript: ENSMODT00000014243
Sequence length 810
Comment pep:known_by_projection chromosome:BROADO5:3:437567077:437616126:-1 gene:ENSMODG00000011178 transcript:ENSMODT00000014243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QELVTFQDVAVYFTPEEVRYLDSYQKALYKDVMLENYGNMASLGFPLSKPVLISQLERGE
EPWAMDPLVAKERKTRRGTSSAYEQDGMLERLPESPSGQSPRKSLSQEREVKLKSSSHKK
NHTREKGFKCNKFGENLVMKSSLVIHHKDPIQEKGHKCDTCGKVFRYNSDLIRHQIIHTG
ERPYECDQCGKTFNQSSHLIQHIRIHTGKKLYKCKDCNKTFAQSSHLIEHQRIHTRERPY
VCSDCGKAFIHCSNLTEHQRIHTGEKPYKCTECGKAFCHSSDLIRHQRIHTGERPYECKE
CGKAFSQSSLLIRHQKIHTGEKPHECKECGKAFIRSSSLIRHQRIHTGERQYDCLECGKA
FRHSSDLIEHQRIHTGEKPYECKECGKAFVRSSKLIQHQRIHTGERPYVCNECGKSFSQT
SNFIQHQRIHTGEKLYECNECGKTFFLSSYLIRHQRIHTGERQYECKDCGKSFLHKAHLG
EHEKIHSGEKPFECKDCGKAFIRSSKLIQHQIIHTGERPYVCKESHKSDTCGKSFRYNSE
LYLHQRIHTGEKPFECTDCEKAFGLNSHLIEHQKIHTGEKPYKCDECGKDFCRRSQLMLH
QRIHTGEKPYECKECGKVFSQSSQLTSHHSTLIQYQRVHTGEKPYKCNACGKAFSQSSHL
ILHQRTHTGEKPHKCHIYGKAFSRSSHLREDQRIHTGEKPYKCNIYCGKVLSQSSYLILH
SRIHTGEKPHECNACGKAFIHSSSLIQHQRVHTGQRSYECNECGKAFSRSSTLIQHQIIH
IGEKIYGCNECGKTFRWNSNLRKHQRIHIR
Download sequence
Identical sequences F6ZZ63
ENSMODP00000013987 13616.ENSMODP00000013987 ENSMODP00000013987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]