SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014101 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014101
Domain Number 1 Region: 74-121
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000694
Family Classic zinc finger, C2H2 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014101   Gene: ENSMODG00000011269   Transcript: ENSMODT00000014360
Sequence length 199
Comment pep:novel chromosome:BROADO5:1:332333304:332341799:-1 gene:ENSMODG00000011269 transcript:ENSMODT00000014360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGSGTKNLDFRRKWDKDEYEKLAEKRLNEEREKKDGKPVQPVKRELLRHRDYKVDLES
KLGKTIVITKTTPQSEMGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSTLD
QVKKRFEVNKKKMEEKQKDYDFEERMKELREEEEKAKAYKKEKQKEKKRRAEEDLTFEED
DEMAAVMGFSGFGSTKKSY
Download sequence
Identical sequences F6X045 G3WVK2
ENSSHAP00000019457 XP_001368725.1.35504 XP_003756665.1.9362 XP_020860847.1.61212 ENSMODP00000014101 ENSMODP00000014101 ENSSHAP00000019457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]