SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014114 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014114
Domain Number 1 Region: 74-121
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000655
Family Classic zinc finger, C2H2 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014114   Gene: ENSMODG00000011277   Transcript: ENSMODT00000014373
Sequence length 199
Comment pep:novel chromosome:BROADO5:1:332342683:332348494:1 gene:ENSMODG00000011277 transcript:ENSMODT00000014373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGSGTKNLDFRRKWDKDEYEKLAEKRLNEEREKKDGKPVQPVKRELLRHRDYKVDLES
KLGKTIVITKTTPQSEMGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSTLD
QVKKRFEMNKKKMEEKQKDYDFEERMKELREEEEKAKAYKKEKQKEKKRRAEEDLTFEED
DEMAAVMGFSGFGSTKKSY
Download sequence
Identical sequences F6WZR1
ENSMODP00000014114 13616.ENSMODP00000014114 XP_001368756.1.35504 ENSMODP00000014114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]