SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014129 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014129
Domain Number 1 Region: 40-100
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.1e-27
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 394-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.63e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 338-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-25
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 4 Region: 282-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.64e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 450-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 785-842
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 506-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.13e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 8 Region: 842-898
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 9 Region: 730-786
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.41e-22
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 10 Region: 883-935
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-20
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 11 Region: 548-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-19
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 12 Region: 676-730
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.45e-19
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 13 Region: 246-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000017
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 14 Region: 627-672
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000143
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014129   Gene: ENSMODG00000023650   Transcript: ENSMODT00000014390
Sequence length 943
Comment pep:novel chromosome:BROADO5:4:400235381:400256421:1 gene:ENSMODG00000023650 transcript:ENSMODT00000014390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METFARVCERALPRQEPALPQERSPEQEEGMAFAVLSERAQESVTFKDVAVDFTQEEWQQ
LDPAQRDLYRDVMLENYKNFVSLGFPVFKPDVISQLERGEGPWTSETEVPQVICPDSIID
KRRCENLDWIPKHNISLGESSKEIIRKNDLWASSFGEAWEYVRLEKQRDNWNRPSKEVTI
FHRKTDDELNINEYNTFGRRFSLASIIVPSQRIPIGKVLHKYDILNKNFKQFSELNKNNR
IPYSVCKYGKCRKPFTYHSDLIQYHRIHTVERPYECNECGKSFTNNSILRNHQRIHTGEK
PYNCNECGKAFNQRGHLTEHQRIHTGEKPYICSECGKAFSNNSILRSHQRIHTGEKPYKC
NECGKTFNQRGHLNEHQRIHTGEKPFECAECGKAFSHRVYLTLHQRIHTGEKPYKCNECG
KAFSQRGHLTEHQRIHTGEKPYICNECGKAFSNNSILRNHQRIHSGERPYKCDECGKTFN
QTRHLIQHQRIHTGEKPFACTECGKAFSHRVYLTLHQRTHTGEKPYKCNECGKTFSQRGH
HTEHQRVHTGEKPYICNECGKAFSNNSILKNHQRIHTGEKPYNCNHCEKAFKQKRHLTDH
QRVHTGEKFLKRLERGKPLSQKARLALQRIHAGEKPFEFNECGNIVNQNSNITLHPIIDT
GEKPFEHNESGKVLFQRGHLIEHQKSHTAEKLFECNECGKNFSKSFHLIEHQRIHTGQKT
FQCNICGKDFSQKGHLTEHKRIHTGEKLFECSVCRKSFSHRTSFINHQKIHSGEKPYECN
ECGKAFSNNSSLWNHHRIHTGEKPFECNECGKAFSQRGHLTEHQKIHTGEKPFECNECGK
HFSHKTSFINHHRIHTGEKPYECNECGKTFRSNSVLRDHERIHTGEKPFECNECGKAFRQ
RGHLAEHRRIHTGKKPFECKECGKAFSTSSTLRKHLCKHLSKL
Download sequence
Identical sequences F6WZD2
ENSMODP00000014129 ENSMODP00000014129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]