SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014303 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014303
Domain Number 1 Region: 135-171
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000363
Family Classic zinc finger, C2H2 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014303   Gene: ENSMODG00000011442   Transcript: ENSMODT00000014567
Sequence length 1497
Comment pep:known_by_projection chromosome:BROADO5:2:204475064:204583618:-1 gene:ENSMODG00000011442 transcript:ENSMODT00000014567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADRFSRFNEDRDFQGNHFDQYEEGHLEIEQASLDKPIESDNIGHRLLQKHGWKLGQGLG
KSLQGRTDPIPIVVKYDVMGMGRMEMELDYAEDATERRRVLEVEKEDTEELRQKYKDYVD
KEKAIAKALEDLRANFYCELCDKQYQKHQEFDNHINSYDHAHKQRLKDLKQREFARNVSS
RSRKDEKKQEKALRRLHELAEQRKQAECALGSGPMFRPTTVAVDEEGEDDKDESTTSGSL
GTSASSGLSNEFITDKGGPFTSVLPSGTTGLGQAPVLAPPAISFGIKNNLGTPLQKLGVS
FSFAKKAPVKLESIASVFKDHAEEGSSEDSTKSDEKGSDPGALQKVGESDSSNNPEGKKE
DEDAHEKDGGSLASTLSKLKKMKREDGTGAAEPEYYHYIPPAHCKVKPNFPFLLFMRASE
QMEGDHSTHPKNNPESKKNNSPKLKSCSKPAVNQGAEKMVNEALVQQKDINVIESTEPKS
KAEAKEAQMDASDQSRNSQQLAENQIPESSPFKEAAQNTPARKEGPEGPKHPTGPFFPVL
SKDESTALQWPSELLIFTKTAPSISYSCNPLYFDFKLSRNKDARAKGIEKPKDPGGPLKE
HFQGSDPGDIKNKEAGNVSHSSGEKTDAMPSGSACSSLHRQDPGESHGEDVEDKGKSLLS
RKERAAKSHRHKKKKKHKKSSKHKRKHKDDPEDKVSKTESGEKSKKRKKRKRKKNKSSAP
TDSERGPKPEPPGSGSPAPPRRRRRTQEDSQRRALPADEGNSSKKEEGGGSSSSAQDHGG
KKHRADPPPSACQRRAGAKRRSSQPSSGDEESDATSSRRQHQKSPSQDSEDDDEDSGSEH
SRSCSRSGRHHSSHRSSRRSYSSSSDASTDQSCYSRQRSYSDDSYSDYSDRSRRHSKRSH
DSEDDSDYASSKHRSKRHKYSSSEDDYSLSCSQSRSRSRSHTRERSRSRSRGRSRSRSSS
CSRSRSKRRSRSTTAHSWQRSRSYSRDRSRSTRSPSQRSDSRKGSRGHESPEERRSGRRD
FIRSKIYRSQSPHYYRSGRAEGPGKKDGRGDDSKGSEPPSQNSSVPTRVSDGDCSPEDKN
SVTAKLLLEKIQSRKVERKPSISEEVLVIPNKVGLKLKDPPQGYFGPKLPPSLGSKSVLP
LIGKLPATRKPNTKKCEESGLERGDEQEQSETEEGPLGIIEATFGHQCPSEDTARPTSDP
LPEEPKPEEGTAEHSTAPLNTPALPNCYPGDSTMPHNYLPEPSDGDALEHLEGTTQPVPG
ESSALPLVPDMEHFPSYAPPSGEPSVESPDGADDASLAPLESQPITFTPEEMEKYSKLQQ
AAQQHIQQQLLAKQVKAFPASAALAPATPALQPIHIQQPATASATSITTVQHAILQHHAA
AAAAAIGIHPHPHPQPLAQVHHIPQPHLTPISLSHLTHSIIPGHPATFLASHPIHIIPAS
AIHPGPFTFHPVPHAALYPTLLAPRPAAAAATALHLHPLLHPIFSGQDLQHPPSHGT
Download sequence
Identical sequences F6W1L3
ENSMODP00000014303 ENSMODP00000014303 13616.ENSMODP00000014303 XP_007482500.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]