SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014338 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014338
Domain Number 1 Region: 206-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.09e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 262-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-24
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 150-207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-21
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 4 Region: 308-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.59e-20
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014338   Gene: ENSMODG00000027717   Transcript: ENSMODT00000014604
Sequence length 369
Comment pep:novel chromosome:BROADO5:X:5311132:5315105:-1 gene:ENSMODG00000027717 transcript:ENSMODT00000014604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISQLEQGEMPWVPHAPGSEEHQTTWLDGPEKGNVESLHNQEISKDEPQWIPLEGIPREQ
GSNLIEPSAYQNGLEGPQENPAEKKLRYSPSKPPSTRLLMTVTHRKSVTKERSHEFHKWE
QSCEPSHNLIAHEGNLMRGQTQSYDSYNHTFKQSSECMKHTRNHRTEKPYKCNECGKSFS
RSSHLIRHQSIHNEEKPYVCNECGKAFSQRSSLIGHQKIHSGEKPYKCNECGIAFIWSSH
LIQHQKIHSGEKPYECNECGKAFSRSSYLIGHQRIHSGEKPYECNECGKTFRWRSALNDH
HSIHNGEKPYECNECGKAFGGRSHLIRHHRIHSGEKPYECNECEKAFSRNSHLIRHQKVH
SGEKFCECD
Download sequence
Identical sequences F6VKE6
ENSMODP00000014338 XP_007506986.1.35504 ENSMODP00000014338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]