SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014365 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014365
Domain Number 1 Region: 296-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000265
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 329-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000688
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014365   Gene: ENSMODG00000011491   Transcript: ENSMODT00000014631
Sequence length 365
Comment pep:known_by_projection chromosome:BROADO5:3:447534879:447538279:1 gene:ENSMODG00000011491 transcript:ENSMODT00000014631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLAEPSLPSINNLASLGLGPLQDTQTRSHKWWQIDEPQDVDLQGAGQWPYQVKQEHRD
PGLWPEQIEGDRGAEGDDPCWDLDFLLTNFPGPGPGPGPGLGPGPGVGSGPGPGPELCLA
HPCGLFPEGPGLMAELQDPKEQPNWGCSVPRPLAVDAVPYGANALPPGPSPSLKVQTGLP
PYSPSCLREGGGSFLQPGPGYPGPTTPVMAPYGLLGTYSTFYPAPHYQARFQLYRREPAP
SSSPGSGSLAFLGPPAPSEPVDEATRPKRSRRPWARKRQAAHTCGHPGCGKTYTKSSHLK
AHLRTHTGEKPYACSWEDCGWKFARSDELTRHYRKHTGQRPFQCQLCSRAFSRSDHLALH
MKRHL
Download sequence
Identical sequences F6V2L6
XP_007489194.1.35504 ENSMODP00000014365 ENSMODP00000014365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]