SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014489 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014489
Domain Number 1 Region: 3-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-22
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 167-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.97e-19
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 197-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000535
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014489   Gene: ENSMODG00000004696   Transcript: ENSMODT00000014757
Sequence length 255
Comment pep:novel chromosome:BROADO5:4:276698522:276699843:1 gene:ENSMODG00000004696 transcript:ENSMODT00000014757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTPSQSSLTFKDVAVDFTQEEWCLLDHSQKELYLKVMLENVQNLFSVGLPVPREYFTSCF
QQGKATWLLEQKSLRNSCPEAETNFEMKEFSTKLRIFVEESDPKRCTNEDSHNFILREIC
DSDIKINKNVKSEYEFDNPSEKFSQYSVLNQCVKLSSGNVSIYHRIHSGEKPYECKQCGK
TFTQGSHLNKHQRIHSGKNPHECKRCGKAFTQRRSLVKHQKIHTGVKSYECKQCGKTFTE
RGYLSKHQRNLMNVN
Download sequence
Identical sequences F6XX06
ENSMODP00000014489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]