SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014511 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014511
Domain Number 1 Region: 283-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.25e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 227-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 66-126
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.55e-23
Family KRAB domain (Kruppel-associated box) 0.00078
Further Details:      
 
Domain Number 4 Region: 329-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.9e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 5 Region: 189-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.1e-20
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000014511
Domain Number - Region: 6-27
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00721
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014511   Gene: ENSMODG00000023561   Transcript: ENSMODT00000014779
Sequence length 384
Comment pep:novel chromosome:BROADO5:4:401698636:401836188:-1 gene:ENSMODG00000023561 transcript:ENSMODT00000014779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHCIGNKGGKSFPQNSKLAGHQRIHTGMQRESFSTLSILLPEEHQSLALGETLEPERMMP
ETQRPPSQESVTFQDVTVDFTQEEWCMLDCSQKKLYREVMLENVQNLLSVGLPVPRENLL
SSCQQGDSPWLLEQKGTRIFRADAEICFEVKEITTKPSLVVKGSGKQGFINEDPYDFILR
ESYESNIKKTYVCKQCGKAFTASYSLSVHQRIHTGEKPYECKQCGKTFTQSSALTEHHRI
HTGEKPYECKQCGKAFTTSCGLGAHQRIHTGEKPYECEQCGKAFRQRGNLAEHQRIHTGE
KPYDCKECGKTFTLNSQLARHQRIHTGTKPYECKQCGKAFTWKSSLAVHQRIHTGEKPYV
YKQCGKAFTASYSLSIHQRIHTGE
Download sequence
Identical sequences F6UZD5
ENSMODP00000014511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]