SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014661 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014661
Domain Number 1 Region: 196-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 786-843
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-26
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 1038-1095
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.15e-26
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 618-675
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.49e-26
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 5 Region: 449-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-25
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 6 Region: 982-1039
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 140-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.44e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 8 Region: 674-731
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.35e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 9 Region: 252-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.91e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 10 Region: 505-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 11 Region: 730-787
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 12 Region: 561-619
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-24
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 13 Region: 926-983
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.14e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 14 Region: 308-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.72e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 15 Region: 842-897
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 16 Region: 392-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-22
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 17 Region: 1-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.49e-20
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 18 Region: 1084-1136
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 19 Region: 87-141
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000448
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 20 Region: 355-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000175
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 21 Region: 887-918
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000181
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014661   Gene: ENSMODG00000023052   Transcript: ENSMODT00000014932
Sequence length 1137
Comment pep:novel chromosome:BROADO5:1:714128911:714196634:1 gene:ENSMODG00000023052 transcript:ENSMODT00000014932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTFKDVAVDFTQEEWCLLSSPQKELYKEVMLENAQNLLSVGLPAPPEDMISYLEQREAPW
MLEQEGLRLMSDGPENFVFRELFVVPQNSSHIEHQRMYTEEKSGESTLCEKTFMQKASLS
GHQSIHIGERPYECKQCGKTFSQRSHLAVHQRVHTGEKPYECKQCGKAFSHSCSLIVHQR
VHTGEKPYECKWCGKTFSWSSSLAAHQRIHTGEKPYECNQCGKTFTNNSKLVVHQRVHTG
EKPYECKQCGKSFSQRFHLAIHQRVHTGEKPYECKQCGKTFSQRFHLAIHQRVHTGEKPY
ECKQCGKTFSQRFHLAIHQRVHTGEKPYKCKKCGKAFSQRFHLAIHQRVHTGEKPYDCKQ
CGKTFRQRFHLTIHHRVHTGEKPYECKQCGKAFSRNFSLVEHHRVHTGEKPYKCTQCGRT
FTNNSNLAAHESRVHTGEKPYECKECGKTFTYNSSLAAHQRVHTGEKPYECKQCGKTFTN
NSNLAAHQRVHSGEKPYECKECGKTFTYNSSLAAHQRVHTGEKPYECKQCGKTFSSRSYL
AVHHRVHTGEKPYECKQCGKSFTNNSSLAAHQRIHTGEKPYECRQCGKTFTYNSKLAVHH
RRIHTGEKPYECKQCGKAFINNSSLAVHQRIHTGEKPYECNQCGKAFINNSSLAVHQRIH
TGKKPYECNQCGKTFINNSSLAVHQRIHTGEKPYECNQCGKTFRQSFKFTVHQRIHTGEK
PYECKQCGKAFSQRFHLAVHQRVHTGEKPYECKQCGKTFRQSFKLTVHQRVHTGEKPYEC
KQCGKTFSQRSHLAVHQRVHTGEKPYECKQCGKTFINNSSLAIHQRIHTGEKPYKCNQCG
KMFRQSFKLTVHQRIHSGEKPYECKQCGKTFIQRFHLAIHQRVHTGEKLYECKQCGKTLS
SRSYFAVHQRVHTGEKPYECKQCGKTFSSRSYFAVHQRVHTGEKPYECKQCGKTFRQSFK
LTVHQRIHTGEKPYECKQCGKTFTNNSSLAVHQRVHTGEKPYECKQCGKTFRNTSNLAVH
QRVHTGEKPYECKQCGKTFTNTSSLVVHQRVHTGEKPYECKQCGKTFTNTSSLAVHQRIH
TGEKPYKCNQCGKAFMNNSSLLVHQRVHTGKRPYECKQCGKTFSQSSQLAHHQRIHT
Download sequence
Identical sequences F7G3G9
ENSMODP00000014661 ENSMODP00000014661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]