SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014705 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014705
Domain Number 1 Region: 167-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.17e-16
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 200-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000114
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014705   Gene: ENSMODG00000011740   Transcript: ENSMODT00000014976
Sequence length 275
Comment pep:known_by_projection chromosome:BROADO5:1:142862540:142962350:1 gene:ENSMODG00000011740 transcript:ENSMODT00000014976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAYVDHFAAECLVSMSNRAIVHSPKEDPDTSPEGTAALPFPNAEDRREGRETGKDNA
SLIVVARILADLNQHVPAPVPPTEKRENVSKKEKLPSRLPPSGEPAQEAASPDSRWSGEA
ATPTSPAGSEPSLKQRSRRGRSRADPESPQKKHRCHYAGCEKVYGKSSHLKAHLRTHTGE
RPFACSWQDCSKKFARSDELARHFRTHTGEKKFSCPICEKRFMRSDHLTKHARRHANFHP
SMLQRRSGGSSRTGSVSDYSRSDASSPTISPASSP
Download sequence
Identical sequences F7DFK4
XP_001365529.1.35504 ENSMODP00000014705 ENSMODP00000014705 13616.ENSMODP00000014705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]