SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014712 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014712
Domain Number 1 Region: 366-721
Classification Level Classification E-value
Superfamily DNase I-like 7.2e-37
Family Sphingomyelin phosphodiesterase-like 0.028
Further Details:      
 
Domain Number 2 Region: 217-362
Classification Level Classification E-value
Superfamily L domain-like 7.57e-24
Family Internalin LRR domain 0.061
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000014712
Domain Number - Region: 204-225
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0628
Family Formin homology 2 domain (FH2 domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014712   Gene: ENSMODG00000011744   Transcript: ENSMODT00000014984
Sequence length 736
Comment pep:known_by_projection chromosome:BROADO5:5:33064659:33132064:1 gene:ENSMODG00000011744 transcript:ENSMODT00000014984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSPTSGRAMGACPVPASPSTSISLPLTLGTLLLISIRSSRGGRLLFSPGPGAWNVDSVS
ERKNRKAAGAEATASASRRSTAPSFPRGGGLRSEPRSQAPRSHLSEPWERGRPASAFPTA
RPGPARLPRAPPGRCLSPPAGCLHVLAALSPAAPAVPAAAAAAPPPSLASPPPPPGARRA
ECRLTGMPKEKYDPPDPRRIYTIMSAEEVANGKKSHWTELEISGRVRSLSTSLWSLTHLT
ALHLNDNYLTRIPPDIAKLHNLVYLDLSSNKLRSLPAELGNMVSLRELLLNNNLLRVLPY
ELGRLFQLQTLGLKGNPLSQDILSLYQDPDGTRKLLNYMLDNLAVHPEQLPPRPWITLKE
RDQILPSASFTVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKGIMEEIVNCDADIISLQ
EVETEQYFTLFLPALKERGYDGFFSPKSRAKIMSEQERKHVDGCAIFFKTEKFTLVQKHT
VEFNQVAMANSDGSEAMLNRVMTKDNIGVAVVLEVHKELFGSGMKPIHAIDKQLLIVANA
HMHWDPEYSDVKLIQTMMFVSEVKNILEKASSRPGSPSADPNSIPLVLCADLNSLPDSGV
VEYLSSGGVADNHKDFKELRYNECLMNFSCSGKNGTSEGRITHGFQLQSAYENNLMPYTN
YTFDFKGVIDYIFYSKTHMNVLGVLGPLDPQWLVENNITGCPHPHIPSDHFSLLTQLELH
PPLLPLVNGVHLPNRR
Download sequence
Identical sequences F7DFC4
XP_016278484.1.35504 ENSMODP00000014712 ENSMODP00000014712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]