SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014851 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000014851
Domain Number - Region: 1338-1343,1485-1520
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000288
Family Formin homology 2 domain (FH2 domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014851   Gene: ENSMODG00000011853   Transcript: ENSMODT00000015123
Sequence length 1805
Comment pep:known_by_projection chromosome:BROADO5:5:34005094:34130618:-1 gene:ENSMODG00000011853 transcript:ENSMODT00000015123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQISQGTIGTPWHQNYHSSSSTSDVSNYSHAYPRRSPDQYSSQGSMESLDHSGNYPPCH
LLSPAKSISSIDQLTHLHNKRDSAYSSFSTSSSIIEYPPTSFSSQECSDTVATTPAQGSL
LEGMRQADIRYVKTVYDSKRGISAEYEVNSSALLPPSGESQESMGDQDYDKWHNHPRSGR
VPLLSWNQQCSSSHETDSNNLPHKVGAPMPPARSGSYTILRHYERPSSWSSSEHNRYGRP
QSSFPGTLKTSFPEEHLHTLLEKSPENSPPVKPKQSYTQTTQPGQPMLPTSIYPVPSPEP
HFAQMPQSSVSSNGMLYPALIKEHGYTASLNTSDKIATLENGNQNGPSKNAVIFYQAPDY
NSPPLVEKVETLGKFFSYKPHFISDSENLRGTSLRKDEPRISEGDYMLPSGKEGLCDNVQ
FSNHHTPRGLKIDESKLLSRPSEPKRAEFQESPNARLQTRPEREDLTEDSWNTSGKTSSS
FLSLQPISPSTRRQNSQEIQVGPQEGNPDNRTACLINMSKMEQEPKKTVLERRDHSDQQT
SRGRPEGGTKGPSSSHNSEPRHEVHRQTSNLTQRQFSSGNALHISHYGKPHFSVLEKVNK
FEQREQGNWRPSSVSSYIYKTNNLERPPSRGSSMISLENHQREISFQEPSPSIGSINVGE
NLVKDSKKKPEAVSWYLPEHQLKRAGDGGHGLTHSESKSLKSAPLLQRSQSTFHLSNKVE
EETLWRENRSSSPESPVFEVPLNQAYRNSIKDAQSRVLGATSFRRRDLDLGPSVASRARQ
RARQRPASAHLGLRSPETTSMSASPHIPKERHNITPTEGSPPREGPAALVARVGGRKRLT
TDQKKRSYSEPEKINEVGVSGAGEPSACYPQRKDVPFGFPENTVANRRRIFEREGKACST
LNLSKPELKQFQQTALADYIQRKTGKRPSSSSGHRPESHSLNAASSMNSLQEQSPIPRRG
SATLSIELIENLERNSPEAQVGPRDRSSSSASSHLRAERHWHPKMEPAQVLWLGEASGQP
SHPQKVTWAPEKPFSLGTTNRGASKSMSAEDLLDRSDVLTVPFHSRSRSSPISDKKCQDM
LLRGNSDYSLLGKVPSSLVGPGFRQFSHSGRSHEEKSSLPHYPGPHLGPHTVPNGSSVPM
ECSKILDSQRPTSRSSAFGPPLAAKQGPFVSAQTSGTNSTYSPRPYLHTERDVLAGRQPS
PKQPQNPRNLEENSVEDLAENDIKKNKGPLPQRPPPPRVKWSQSLREDNLPEPSLPFGVP
SQKHYPQHQSLSSTSTTCHPNSLPGLLTVTGKGSLPISESAFRAIPLPQEEDDDEVFVQE
SRPRPTPNPTFKTLPLLPPPPPPPSPPPLDLKAQDSNLEDFPPPPPPITYEALGTLSSET
YEEETCTSKSKMMLAASQRASTSRPSSFIKTLGAKQTNLLSPLAAQNQPIGILGEQSSPE
QMLPTQFPKFIQKPNNLTQELAKGSPGPEKTLEDISTETLAKQIVHQDKSLADILDPDSR
MKTTMDLMEGLFPQGPSFLKENNIRKKAIQRIASFPVSEGKRSTEKERVGMLINCPAYYN
VSAPKAELLNKLKSMPAEGDEDEDQLDVNEKKAKLIRSLRHKLESLKEAKESLFMDIKLN
NALGEEVEVLVCKLCKPNELDKYKMFVGDLDKVVNLLLSLSGRLARVENVLSGLGEDADS
EEWSSLNEKKKVLAGQHEDARELKENLDRRERVVLDILANYLTTEQLQDYQHFVKMKSTL
LIEQRKLDDKIKLGQEQLNCLLESLPRDFLTEARTPAAPLTPETEMTPDGDCTFRSGLPP
LISSL
Download sequence
Identical sequences F7GDF6
ENSMODP00000014851 ENSMODP00000014851 XP_007495856.1.35504 XP_007495857.1.35504 XP_007495858.1.35504 XP_007495859.1.35504 XP_007495860.1.35504 XP_007495862.1.35504 XP_007495863.1.35504 XP_007495864.1.35504 XP_016278486.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]