SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014983 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000014983
Domain Number - Region: 319-326
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0154
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014983   Gene: ENSMODG00000011955   Transcript: ENSMODT00000015258
Sequence length 684
Comment pep:known_by_projection chromosome:BROADO5:1:111409936:111413793:-1 gene:ENSMODG00000011955 transcript:ENSMODT00000015258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIVQTLAVPLEATPESAAPHPPHLPTMGSVSSLISGRPCPGGGPAPCHHTPSGPPFFRQ
QDGLLLRGGGCRVQEPLCPPVPTRKPMGNAGFAYINEDFRGDSPSSPCSDTEDVREQARS
AHLRGPPPKLIPVSGKLEKNMEKILIRPTAFKPVLPKPRGPPSLPAFLGPRAGVGGLSGS
QGSLTQLFGGPASSSSSSSSSSAEKPLTLSGWASGCPSGTLSDSGRNSLSSLPTYSTGGA
EPVGGSPVGHLPSDGPGRGVLPGTGGSHRGVPIGPSNSDSGRSSSSKSTGSRGGLLSGGG
TRVSPDSGSCGDRSPLPGPPPPPPPPLPDESLLRCALQEKLREREAELQQLRDSLDENEA
AICQVYEEKQRRWQREREELQEGCVAQVKQATQRAQRAQQLLQLQVFQLQQEKRQLQDDF
AQLLQEREQLERRCAAFEREQNELGPRLEETKWEVCQKSGEISLLKQQLKESQAELVQKG
SELAALRVALREARASLRASEGRARGLQEAARARELELEVCTHELHRRKNEAEWLREKAG
QLDVAVAGLRGAQEPLPVPAPDPFLMSESDEAKAQRAAAAGAGGSLRAQVERLRAELQQE
RRRAEEQQGGFESERLAWQAEKEQVIRYQKQLQHNYIQMYRRNRQLEQELRHLSLELEAR
DLADYSLPETPPCVHLEEITATEI
Download sequence
Identical sequences F7CV17
XP_001369938.1.35504 XP_007479214.1.35504 XP_007479215.1.35504 XP_007479216.1.35504 ENSMODP00000014983 13616.ENSMODP00000014983 ENSMODP00000014983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]