SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015087 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015087
Domain Number 1 Region: 852-892
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000405
Family HkH motif-containing C2H2 finger 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015087   Gene: ENSMODG00000012042   Transcript: ENSMODT00000015366
Sequence length 1470
Comment pep:known_by_projection chromosome:BROADO5:1:7792234:8205345:1 gene:ENSMODG00000012042 transcript:ENSMODT00000015366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPCLPDWNVSTTWGSKSMGSAKNVISEPVEVEEDYRIMIRSLRLDLNGSLPHSRPRALS
TAPPAYCYKASFQRSNSHDKVREIVAEEGRTARNLIAWSVPLENKDDDGKSKWHTGGKSK
RTIQGTHKTAKQNVTVDCKITSSSAGDKHFEKSPTKTRHPRKIDLRARYWAFLFDNLRRA
VDEIYVTCESDQSVVECKEVLMMLDNYVRDFKALIDWIQLQEKLEKADAQSRPTSLAWEV
KKMSPGRHVIPSPSTDRINVTSNARRSLNFGGPSGPIAATRLAPAGVSWADKVKANHSVT
AAPANTAPVQSCPPVTVQKASRRNDRKDAEGWETVQRGRPVRSRSTAVAPKEPVITEPLR
SKDDSDKENVLLFPVESQQKGGLPGEGPSAIIEPQPKDPVAPCEHPLAERTQFTVCTSDD
SRSSGSGLVPENSLQNSCEIPALHVDAECIPDTPQTDPSPLQSPTDQFPAEKAQIESEMD
PSDISNSMAEVLAKKEELADRLEKANEEAIASAIAEEEQLTREIEAEENNDINLEADNDS
DFSASVSSGSISFCGMSMDWNDVLADYEARESWRQNTSWGDIVEEEPARPPGHGIHMHEK
LSSPSRKRTIAESKKKHEEKQMKAQQLREKLREEKTLKLQKLLEREKDVRKWKEELLDQR
RRMMEEKLLHAEFKREVQLQAIVKKAQEEEAKVNEIAFINTLEAQNKRHDVLSKLKEYEQ
RLNELQEERQRRQEEKQARDEAVQERKRALEAERQARVEELLMKRREQEARIEQQRQEKE
KAREDAARERARDREERLAALTAAQQEAMEELQKKIQLKHDESVRRHMEQIEQRKEKAAE
LSSGRHASTDYAPKLTPYERKKQCSLCAILISSEVHLFSHIKGKKHQQAVRENSSIQGRE
LSDEEVEHLSLKKYIVDIVIESSTPTEPVKDGDDRQKNKKKAKKLKARMNSRAKEYESLM
EAKNPSSDSPYKAKLQRLAKDIIKQLHIQDSGSWAVNKVSALDRTLGEISRILEKENVAD
QIAFQVAGGLTALEHILQVVNSTTSMNAVSRLPPKSLSNAINVYNLTCSNCSENCAYVLF
SNKITFLMDLLIHQLTVYVPDENNAILGRNANKQVFEGLTTGLLRISAVVFGCLISNMPD
GNSRLPAPKTSSQETKSKPSPVDAFNSRVQDLISYVVNIGLIDKLCGCFLSVQGPVDENP
KVASFLQNATAVLHGMCKLCFAVNSKSWDIFDKIRQDPTGLAAALQATDLVGVLHMLYCI
LFHGTISDPTTASPKDSYAQSTIQVALQSLRFFNSFAVLDLPAFQSIVGAEGLSLAFRHI
LSSLLWHCTHHSCELLLHEVIICVGYFTVNHPDNQVIVQSGRHPTVLQKLCQLPFQYFSD
PRLIKVLFPSLIAACYNNPQNKIILEQEMSCVLLATFIQDFEPIPGQTEDLYPQTREKFF
TSQDYLELCNRFPEQAWEEARQFFLKKEKK
Download sequence
Identical sequences F7ALG9
ENSMODP00000015087 ENSMODP00000015087 XP_007478042.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]