SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015101 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015101
Domain Number 1 Region: 446-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000502
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000015101
Domain Number - Region: 995-1016,1064-1091
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000161
Family Classic zinc finger, C2H2 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015101   Gene: ENSMODG00000012054   Transcript: ENSMODT00000015381
Sequence length 1358
Comment pep:known_by_projection chromosome:BROADO5:2:13387515:13497023:1 gene:ENSMODG00000012054 transcript:ENSMODT00000015381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAEAEEAELVRHKEPGAGVRGRGRGGGGSGGGGGRGRGRGRGGRRNLRANVFNGLANN
NMDDPKINTEITGAKEELLSDTNFISEKESGILKPQECQMSFQKNNTLTLPEELSRDRSE
KALSGGQSTLFIRAGAPTVSSEKFILPKGTAVNGPVSHSLTKTSIMSKGSISLTTGQPMS
QQTTDSCSTLKVAHDLQLSTKTTPEKSNQHQVLYLLPDVAQTKNPTHSIKKPTSASAGCD
KQKSVGSSVKSDSTLINQVKGCEESESLLAKDDCVKTLTGISSGTDDFRSENETNWDPQK
EFIQFLMTNEETIEKSPVHCKVGLEKKRKRKMDVSKIMRYTEDCFSDSNYMTTKSKLLNV
EFVEQSEELQITEPQKYPLSKVKPESADEDLDDVDAIQQLIYSPDKCGEESSPVHTSTFL
SNTLKKKCEESDSESPATFSTEEPSFYPCTKCNVNFREKKHLHRHMMYHLDGNSHFRHLN
VPRPYACRECGRTFRDRNSLLKHMIIHQERRQKLMEEIRELKELQDEGRSARLQCPQCVF
GTNCPKTFVQHAKTHEKDKRYYCCEECNFMAVTENELECHRGIAHGAVVKCSVINSDLSQ
RKTQKKISVKDPLTESSKKPSTYMCKLCAFTTSARNILKKHMEYLHPSSCIDPFGRQLRL
EKKGDIVEEPLDFGRTKSLIKEQTSTFPKNSVLKQDVKRTFGSASQSSSFSKLHKRTNRV
QKARKSVSQAGVNVCNQNNSPHKTMIKNSIDQKPKYFHQTGKQKPSVKSSSNYLYRHKYE
NYRMIKKSSDPYPLHLKKEEASSLHVFSSSGSSHNNCFIMDSQTLDPKRPDDFKDYRHVA
VKRVINESKMESSVAGDDLDCYPDFLHKMTVVVLQKLNSAEKKDSYETEDDSSWDNVEMC
DYTTESIEDESYSDVNQENVNLFPLFKNKVDGQEVGENLSFEQNDGFYFEYYEDAETSNY
LHDIHDPQQLENAETSLPKHNSLFHWTDLSLEKKSCPYCPATFETGVGLSNHVRGHLHRA
GLSYEARHVVSPEQIATSDKMQHFKRTGTGTPVKRVRKAIEKSESASEHTCQLCGGWFDT
KIGLSNHVRGHLKRLGKTKWDAHKSPICVLNEMMQNEEKYAKILKALNSRRIIPRPFVAQ
KLTSSDDFLSENVIPLEAYRNGLKTEAVSVSASGEEGLSFLSESDETKAELSSGKKNQSL
TLIELLKNKRLGEERNPDISPQKIHNQTARKRFVQKCVLPLDEDGPLTYQPQKMDLSVQS
AIDSKQKKSRSRSGSKKKVLPLPHGADDIYILRCRFCGLVFRGPLSVQEDWIKHLQRHIV
NANLPRTGAGMVEVTSLLKKPASITETSFSLLMAEAAS
Download sequence
Identical sequences F7GF84
ENSMODP00000015101 XP_007480407.1.35504 XP_007480408.1.35504 ENSMODP00000015101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]