SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015106 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015106
Domain Number 1 Region: 231-297
Classification Level Classification E-value
Superfamily Homeodomain-like 5.13e-22
Family Homeodomain 0.0013
Further Details:      
 
Domain Number 2 Region: 77-147
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000549
Family beta-sandwich domain of Sec23/24 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015106   Gene: ENSMODG00000012056   Transcript: ENSMODT00000015386
Sequence length 301
Comment pep:known_by_projection chromosome:BROADO5:2:13716197:13930148:1 gene:ENSMODG00000012056 transcript:ENSMODT00000015386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAMEGASGSSFGIDTILSSASSGSPGVMNGDFRQHVDGRSTDFRSQATPSPCSEIDTVG
TAPSSPISVTLEHPEPHLVQDGIQHHHHLHHGQPPPPPPQQQPQPPPPTQSLQSSPQQQP
QQQPPSQPQPQPQLGSAASAPRTSTSSFLIKDILGDSKPLAACAPYSTSVSSPHHTPKQE
GNAANESFRPKLEQEDSKTKLDKRDDVQNDVKCHGTKEEGDREITSSRESPPVRAKKPRK
ARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQNRRNSWKKTTGLE
L
Download sequence
Identical sequences F7GF75
ENSMODP00000015106 ENSMODP00000037524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]