SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015144 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000015144
Domain Number - Region: 50-56,86-91
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00654
Family Formin homology 2 domain (FH2 domain) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015144   Gene: ENSMODG00000012091   Transcript: ENSMODT00000015426
Sequence length 314
Comment pep:known_by_projection chromosome:BROADO5:3:485028598:485052287:1 gene:ENSMODG00000012091 transcript:ENSMODT00000015426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPEPAPPPPSSSSPELPLASGGRGSSPPISGSRRSRRRSGDAEPPGAAPPPPPPPLPGA
AVSYPDWVGQSYQEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQ
LDASHDYPPGLLIAFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERM
HRHIELAWAFSTVIGTLLFLAEVVLLCWVKFLPLKKQPEPPQPSKSPAAVGSHGPGASNA
SFTPGQEAAIASTTIMVPFGLVFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLD
HRGDHPLTPGGHFA
Download sequence
Identical sequences F7G4P2
ENSMODP00000015144 ENSMODP00000015144 XP_001364272.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]