SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015300 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015300
Domain Number 1 Region: 704-761
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 536-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.08e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 368-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.28e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 480-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 648-705
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 312-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 7 Region: 760-817
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.32e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 8 Region: 257-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.8e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 592-649
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.8e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 10 Region: 424-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.04e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 11 Region: 35-94
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.98e-21
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 12 Region: 802-854
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.3e-18
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015300   Gene: ENSMODG00000022654   Transcript: ENSMODT00000015585
Sequence length 868
Comment pep:novel chromosome:BROADO5:Un:62430835:62448654:-1 gene:ENSMODG00000022654 transcript:ENSMODT00000015585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTKLRLFVEGSGVQRCMNEVPHDCILREICDSDMQGSLTFKDIAVDFTQEEWCLLDHTQ
KELYLEVMLENVQNLFSVGLPVPREYCTSCFQQGKVPWQLEPKGPRSSCPEAETNFEVKD
MSTKLRIFVQESDPKRWINDAHGFILREISDSDMKINKNIQSDCEFDDPSEKFSQCSVFN
QYMKMTSGNDYCQNSKYSKCFPEEVRLFQLNEKPSEKPMYQGNLGGMAFSYNLDFIRHTK
SKWVEMVSVRNEVEKPFSQNSNLAAHQIIDSGEKPYECEQCGKAFKQRVSLVVHHRIHSG
EKPYECKHCGKAFTERGSLTRHQLIHTGEKPYECKECGKTFIERRYLAKHQRIHSGEKPY
ECKQCGKAFTESSSLAAHQRIHTGEKPFGCKQCGKAFTQSRYLAAHQRIHTGEKPYECKQ
CGKAFTQRSQLAAHQSIHTGEKPFECKECGKTFKRRKSLAKHQRIHTGENLYECKHCGKA
FTESSSLAVHQRIHTGEKPFECKQCGKAFTQSRYLAAHQRIHTGEKPYECKECRKTFIER
RSLDNHQRIHTGEKPYECKQCGKAFTQSSSLAAHQRIHTGEKPFECKECGKTFIERRSLA
KHQRMHSGEKPYECKQCGKAFIERRSLVKHQRIHSGEKPYECKQCGKAFAQGSHLLRHQL
IHTGEKPYECKHCGKAFTQSCYLAAHQRIHTGEKPYECKECGKTFKERRSLAIHQRIHTG
EKPYECKQCGKAFTQSSSLAAHQRIHTGEKPFECKECGKTFIERRSLAKHQRIHTGEKPY
ECKHCGKAFTYSCSLATHQLIHTGEKPYECKQCGKTFRQRSNLATHQRNHTGEKSFESKH
CGKAFPHRNSLAIHQLIHTGEKKPYCIG
Download sequence
Identical sequences H9H6J5
ENSMODP00000015300 XP_016282969.1.35504 XP_016282970.1.35504 ENSMODP00000015300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]