SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015319 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015319
Domain Number 1 Region: 1076-1128
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.76e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 443-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000016
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 707-758
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000415
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 4 Region: 744-793
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000735
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015319   Gene: ENSMODG00000012231   Transcript: ENSMODT00000015604
Sequence length 1265
Comment pep:known_by_projection chromosome:BROADO5:3:309572562:309595685:1 gene:ENSMODG00000012231 transcript:ENSMODT00000015604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRKQAKPQHLKSDEELQQSEVVSEHAVPGEGADDGDSGNESRSGSEETNVCEKCCAEF
FKWTDFLEHKKNCTKNPLVLIVNEDEPAPPSEEFPEPSPASSPSDQAESEVTEETIQPEN
NESCEVKVAEKEEEPMEVETSGEKSYQNQGTSNATPTTPLPQIPEPSSMTSYNMPNTNVT
LETLLSTKVAVAQFSQNARSSGSANASSGVTAMAIPMILEQLMALQQQQIHQLQLIEQIR
SQVAMMNRQPLRPSLNPAVASQNAPVAASNQLQGFAAHSALQLTTAVPPTVAGQATNNPP
STFEGPQHISQPPSGASTPNISTSGSSAPTEPSASSSATAIPAPITPASVSNTTNSSSQP
QNTSTPPTLGHGNLLTSTSSLPNPLLPQTSSNSVIFPNPLVSIAATANALDPLSALMKHR
KGKPPNVSVFEPKSSSEDPFFKHKCRFCAKVFGSDSALQIHLRSHTGERPFKCNICGNRF
STKGNLKVHFQRHKEKYPHIQMNPYPVPEYLDNVPTCSGIPYGMSLPPEKPVTTWLDSKP
VLPTVPTSIGLQLPPTIPGVNSYSDSPSITPISRSPQRPSPASSECTSLSPGLNNSESGI
TVTAESPQPIHSGSSLTKTEPISLPSTNTRVGEVSISVQVTTVSTSIVTTVTDSSVSTTL
PNPGLPAISDQFKAKFPFGGLLDSMQTSETSKLQQLVENIDKKMTDPNQCVICHRVLSCQ
SALKMHYRTHTRERPFKCKICGRAFTTKGNLKTHFGVHRAKPPLRVQHSCPICQKKFTNA
VVLQQHIRMHMGGQIPNTPLPEGFQDAMDSELSYDDKNIDTLSNYDDDIDENSMEEDPEL
KDTASDSSKPLIAYSGSCPPSPPSVISSIAALENQMKMIDSVMNCQQLTSLKSIENGSGE
SDHLSNDSSSAVGDLESQSAGSPAMSESSSSMQALSPVNSNSESFRSKSPGLSNQEDPQE
TPLKTEKPDSPPPAPENGGALDLTAPTPGRPVIKEEAPFSLLFLNRERGPSQSTPSLVTS
TAPTMIKMEVNGHSKPISLGEGPPLPAGIQVPAAPQTVMSPGLTPMLAPPPRRTPKQHNC
QSCGKTFSSASALQIHERTHTGEKPFGCTICGRAFTTKGNLKVHMGTHMWNNAPARRGRR
LSVENPMALLGGDALKFSEMFQKDLAARAMNVDPNFWNQYAAAITNGLAMKNNEISVIQN
GGIPQLPVSLGGSAIPPLSNITSGMDKARTGSSPPIGGLDKASSETGASRPFTRFIEDNK
EIGIN
Download sequence
Identical sequences F6Z6N0
ENSMODP00000015319 ENSMODP00000015319 XP_001374606.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]