SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015339 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015339
Domain Number 1 Region: 322-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 2 Region: 546-603
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.15e-26
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 98-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.82e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 602-659
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 210-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 266-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.63e-25
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 7 Region: 490-547
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.1e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 8 Region: 154-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.26e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 9 Region: 378-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.51e-23
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 10 Region: 434-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-21
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 11 Region: 644-694
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-20
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 12 Region: 43-99
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-20
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 13 Region: 1-52
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000086
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000015339
Domain Number - Region: 697-718
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000393
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015339   Gene: ENSMODG00000012250   Transcript: ENSMODT00000015625
Sequence length 718
Comment pep:novel chromosome:BROADO5:Un:98367887:98370107:1 gene:ENSMODG00000012250 transcript:ENSMODT00000015625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGEKFLQCPQCRKAFNKSSKLILHQRIHVGENPNECNDCGKGFHHRSKLNIHWRAHTRKN
PYQCNDCGKMFINDSKLILHQRIHTDEKPFKCNDCGKVFSHRSKLIIHQRIHTGEKPFKC
DDCGKAFNQNSKLVQHQRIHTGEKPFKCNDCGKTFNQNFNLSVHQRIHTSERPFQCNDCG
KAFNQSSHLLQHQRIHTGEKPFKCDDCGKAFNQSSHLLQHQRIHTGEKPFKCHDCGKAFI
RSSTLLQHQRIHTDEKPFKCDDCGKAFYQNSHLLKHHRIHTGEKPFKCNDCGKTFNQSSH
LLQHQRIHTGEKPFKCNDCGKAFSQRSKLIIHQRIHTGEKPFKCNDCGKAFNQSSHLLQH
QRIHTGEKPFKCNDCGKAFSQRSKLIIHQRIHTGEKPFKCNDCGKAFNQSSYLLQHQRIH
TGEKPFQCHGTGMAFNQNSNISVQQRIHTSERPFRCNDCGKAFNQSSHLLQHQRVHTCEK
PFKCNDCGKVFSHRSKFIIHQRIHTGEKPFKCDDCGKAFIRSSTLLQHQRIHTDEKPFKC
DDCGKAFNQNSNLLQHQRIHTGEKPFKCDDCGKAFNQNSHLLQHQRIHTGEKPFQCHDCG
KAFNQWSHLLQHQRIHTGEKPFKCNDCGKAFSQRSKLNVHQRIHTGEKPFQCHDCGKAFS
QRSKLIIHQRIHTDEKPFKCNDCGKAFNQSSNLIRRNFLVHQRIHTGEEPYKCEGCEK
Download sequence
Identical sequences H9H6J8
13616.ENSMODP00000015339 ENSMODP00000015339 ENSMODP00000015339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]